[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : fabK
DDBJ      :fabK         enoyl-acyl carrier protein (ACP) reductase II
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  424/915 : Eukaryota  90/199 : Viruses  0/175   --->[See Alignment]
c.1.31c.1.5
:324 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->320 2z6jA PDBj e-151 99.7 %
:RPS:PDB   3->296 3bw4A PDBj 3e-49 26.7 %
:RPS:SCOP  101->213 1tygA  c.1.31.1 * 9e-18 24.1 %
:HMM:SCOP  1->323 1pvnA1 c.1.5.1 * 5.8e-66 32.6 %
:RPS:PFM   5->302 PF03060 * NPD 1e-42 41.8 %
:HMM:PFM   2->302 PF03060 * NPD 1.7e-90 41.8 294/323  
:BLT:SWISS 1->289 2NPD_STAS1 1e-29 34.2 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55489.1 GT:GENE fabK GT:PRODUCT enoyl-acyl carrier protein (ACP) reductase II GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 376891..377865 GB:FROM 376891 GB:TO 377865 GB:DIRECTION + GB:GENE fabK GB:PRODUCT enoyl-acyl carrier protein (ACP) reductase II GB:NOTE identified by match to protein family HMM PF03060; match to protein family HMM TIGR03151 GB:PROTEIN_ID ACF55489.1 GB:DB_XREF GI:194357041 GB:GENE:GENE fabK LENGTH 324 SQ:AASEQ MKTRITELLKIDYPIFQGGMAWVADGDLAGAVSKAGGLGIIGGGNAPKEVVKANIDKIKSLTDKPFGVNIMLLSPFVEDIVDLVIEEGVKVVTTGAGNPSKYMERFHEAGIIVIPVVPSVALAKRMEKIGADAVIAEGMEAGGHIGKLTTMTLVRQVATAISIPVIAAGGIADGEGAAAGFMLGAEAVQVGTRFVVAKESNAHPNYKEKILKARDIDTTISAQHFGHAVRAIKNQLTRDFELAEKDAFKQEDPDLEIFEQMGAGALAKAVVHGDVDGGSVMAGQIAGLVSKEETAEEILKDLYYGAAKKIQEEASRWAGVVRND GT:EXON 1|1-324:0| BL:SWS:NREP 1 BL:SWS:REP 1->289|2NPD_STAS1|1e-29|34.2|284/355| SEG 36->44|gglgiiggg| SEG 167->180|aaggiadgegaaag| BL:PDB:NREP 1 BL:PDB:REP 1->320|2z6jA|e-151|99.7|307/307| RP:PDB:NREP 1 RP:PDB:REP 3->296|3bw4A|3e-49|26.7|285/347| RP:PFM:NREP 1 RP:PFM:REP 5->302|PF03060|1e-42|41.8|292/312|NPD| HM:PFM:NREP 1 HM:PFM:REP 2->302|PF03060|1.7e-90|41.8|294/323|NPD| GO:PFM:NREP 2 GO:PFM GO:0018580|"GO:2-nitropropane dioxygenase activity"|PF03060|IPR004136| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03060|IPR004136| RP:SCP:NREP 1 RP:SCP:REP 101->213|1tygA|9e-18|24.1|112/242|c.1.31.1| HM:SCP:REP 1->323|1pvnA1|5.8e-66|32.6|301/0|c.1.5.1|1/1|Inosine monophosphate dehydrogenase (IMPDH)| OP:NHOMO 885 OP:NHOMOORG 515 OP:PATTERN -----------------------1-------------------------------------------- 1---11-----1--33233-35--3232333243433488-1-----------1------113-12-111---------114---11111211111---111112311-1---------------------------------------1--------------1---------------------1111--11111111111111111-31111111133221-22222221-111111111111111--211---11-1---11--11-1-11111-11121111211111111111111111111211111111111111-22221112111112-1221111-1---222322222121211111-1211--5443-----1-52221-11331-------------1---2----8-----21--1-1-12-4--1--------22222222111112211111111111---------------1111-23542----5-1-3311----1121----1-4113464--222--122211121-1-----2-------------1281311-1-11--11-1-11111-111111---1111111111---------1-111--11--3---31-1------1111--11------------------------------------------------------122----------1--11-------------------------------------1111-1--11112-------1---111-1-111--1222211--1---1-222--------------------1-------------------1-111111----------1-------------------------1222211111-1- ----1---31--11335535353636344333333333132333333333333333333333----1-------1-----1--------34252224-11112233--1-------------------------------------------------1-------------------17111--113132111--12- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 321 STR:RPRED 99.1 SQ:SECSTR cccTTTTTccccccEEEcccTTTccHHHHHHHHHTTccEEEEcTTccHHHHHHHHHHHHHHccccEEEEEEccccTHHHHHHHHHHccccEEEEEcccccHHHHHHHHTTcEEEEEEccHHHHHHHHHTTccEEEEEcTTccEEcccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHTTccEEEEcHHHHTcTTccccHHHHHHTTcGGGccEEEEcTTTcccEEEEccHHHHHHGGGccccTGGccccTTHHHHHHHHHHHHHHHHTcGGGccccccTTGGGcccccHHHHHHHHHHHHHHHHHHHHHHHHTTcc### DISOP:02AL 323-325| PSIPRED cccHHHHHHcccccEEEccccccccHHHHHHHHHcccEEEEEcccccHHHHHHHHHHHHccccccEEEEEEcccccHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEcccHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHccccEEEEcccEEEEccccccHHHHHHHHHcccccEEEEEEccccEEccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHcccccccEEEccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccc //