[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : fabM
DDBJ      :fabM         trans-2, cis-3-decenoyl-ACP isomerase
Swiss-Prot:             

Homologs  Archaea  33/68 : Bacteria  561/915 : Eukaryota  155/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:269 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   4->258 3gowF PDBj 4e-29 34.7 %
:RPS:PDB   2->259 2ej5A PDBj 2e-41 30.9 %
:RPS:SCOP  2->260 1jxzA  c.14.1.3 * 2e-43 19.7 %
:HMM:SCOP  2->258 2fw2A1 c.14.1.3 * 5.7e-69 34.8 %
:RPS:PFM   13->183 PF00378 * ECH 9e-18 31.5 %
:HMM:PFM   14->183 PF00378 * ECH 5.2e-37 34.1 167/170  
:BLT:SWISS 1->261 PAAG_ECOLI 2e-24 33.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55486.1 GT:GENE fabM GT:PRODUCT trans-2, cis-3-decenoyl-ACP isomerase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 374200..375009 GB:FROM 374200 GB:TO 375009 GB:DIRECTION + GB:GENE fabM GB:PRODUCT trans-2, cis-3-decenoyl-ACP isomerase GB:NOTE Marrakchi, H.; 2002 J.Bio.Chem 277:44809-44816; identified by match to protein family HMM PF00378 GB:PROTEIN_ID ACF55486.1 GB:DB_XREF GI:194357038 GB:GENE:GENE fabM LENGTH 269 SQ:AASEQ MEHIIYQLEEDLAILTLNRPEVANGFHIPMCEEILEALTLAEENPAVHFILINANGKVFSVGGDLVEMKRAVDEDDIPSLTKIAELVNTISYKIKQIAKPVLMEVDGAVAGAAANMAVAADFCLATDKAKFIQAFVGVGLAPDAGGIHLLSRSIGVTRAAQLAMTGEALTAEKALEWGLVYRVSEAEKLEKTREQLLKKLRRASSNSYAAIKKLVWESQFKDWQGYATLELNLQKSLAQTEDFKEGVRAHSERRRPKFTRKIKNTCIIL GT:EXON 1|1-269:0| BL:SWS:NREP 1 BL:SWS:REP 1->261|PAAG_ECOLI|2e-24|33.6|259/262| SEG 32->43|eeilealtlaee| SEG 107->120|gavagaaanmavaa| BL:PDB:NREP 1 BL:PDB:REP 4->258|3gowF|4e-29|34.7|248/252| RP:PDB:NREP 1 RP:PDB:REP 2->259|2ej5A|2e-41|30.9|246/250| RP:PFM:NREP 1 RP:PFM:REP 13->183|PF00378|9e-18|31.5|168/170|ECH| HM:PFM:NREP 1 HM:PFM:REP 14->183|PF00378|5.2e-37|34.1|167/170|ECH| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF00378|IPR001753| GO:PFM GO:0008152|"GO:metabolic process"|PF00378|IPR001753| RP:SCP:NREP 1 RP:SCP:REP 2->260|1jxzA|2e-43|19.7|259/268|c.14.1.3| HM:SCP:REP 2->258|2fw2A1|5.7e-69|34.8|256/0|c.14.1.3|1/1|ClpP/crotonase| OP:NHOMO 2670 OP:NHOMOORG 749 OP:PATTERN 22-1--4987888876-12121184111-215-----------------------------1311-11 232151-3--22119MC55-5B228I555556IIMI9BRP-728--12----432312--548-18A7374--------1417-----1111-1211--2-1111432-1--------------11111121111145533---46-11111-11--------------11------------22222---6445555544646464443744446644A775411111118--1111111111111111111------------------1---111111111111111111111111111111111111111111111111--1131111111212-2221221-2-1-2-11-451425-15---1--2-3--866C-----2-HAA322E7GBB45544552553---2--41366J-122-33535654575C34572333376--------4---1653-----------------------------19BE6-4MFBG4674C45333355A744443585LDLNI1298652586B8BBBC225----42----------C682N861---------15541A12---11-4312---------------------------211251625231343332533333352432-------------2-1121-5333532355-3555322535333335334232--212122111111111111142223333--1--------------1-----1111-3313---11--1111111199889253422133336534276774222-------------1-----1412222---------------1444421------------------------------------------------1 ----423-321-33242116444323222121122136333333-333333343211121112-------1------------------24-2232111-112323-52244533432212121212122D2-223-12131132--22-11-31221622122231313644422111A---1343491421211111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 266 STR:RPRED 98.9 SQ:SECSTR cccEEEEEETTEEEEEEccGGGTTcccHHHHHHHHHHHHHHHHcTTccEEEEEEccccccccccccHHHHHHHTHccccHHHHHHHHHHHHHHHHHccccEEEEEccEEETHHHHHHHHccEEEEETTcEEEccGGGGTccccTTHHHHHHHHHcHHHHHHHHHHcccEEHHHHHHHTcccEEEcGGGHHHHHHHHHHHHHTccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcHHHHHHHHHHTTTccccccHHHHHHH### PSIPRED ccEEEEEEEccEEEEEEccHHHHccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHccEEEEccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHcccccEEccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccHHHccc //