[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : fabT
DDBJ      :fabT         fatty acid biodynthesys transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  134/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:144 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->129 1jgsA PDBj 3e-08 28.6 %
:RPS:PDB   32->143 3bpxB PDBj 2e-15 20.5 %
:RPS:SCOP  8->141 2ethA1  a.4.5.28 * 9e-22 20.1 %
:HMM:SCOP  4->142 1lj9A_ a.4.5.28 * 2.8e-28 27.9 %
:HMM:PFM   33->91 PF01047 * MarR 6e-14 33.9 59/59  
:BLT:SWISS 32->144 YFIV_BACSU 1e-09 28.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56396.1 GT:GENE fabT GT:PRODUCT fatty acid biodynthesys transcriptional regulator GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 375080..375514 GB:FROM 375080 GB:TO 375514 GB:DIRECTION + GB:GENE fabT GB:PRODUCT fatty acid biodynthesys transcriptional regulator GB:NOTE Sullavik, M.C. 1995 Mol.Med.1:436-446; identified by match to protein family HMM PF01047; match to protein family HMM PF03965 GB:PROTEIN_ID ACF56396.1 GB:DB_XREF GI:194357948 GB:GENE:GENE fabT LENGTH 144 SQ:AASEQ MDYQRINEYLTSIFNNVLVIEEVNLRGSRFKDISIKEMHTIDVIGKAPDVTPSQVSKELMVTLGTVTTSLNNLERKGYIERVRSEQDRRVVHLHLTKKGRLIHRLHKRFHKAMVEKIIDGMSEEEIAVMGKGLTNLYQFLEDLK GT:EXON 1|1-144:0| BL:SWS:NREP 1 BL:SWS:REP 32->144|YFIV_BACSU|1e-09|28.6|112/160| BL:PDB:NREP 1 BL:PDB:REP 32->129|1jgsA|3e-08|28.6|98/138| RP:PDB:NREP 1 RP:PDB:REP 32->143|3bpxB|2e-15|20.5|112/138| HM:PFM:NREP 1 HM:PFM:REP 33->91|PF01047|6e-14|33.9|59/59|MarR| RP:SCP:NREP 1 RP:SCP:REP 8->141|2ethA1|9e-22|20.1|134/140|a.4.5.28| HM:SCP:REP 4->142|1lj9A_|2.8e-28|27.9|136/144|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 147 OP:NHOMOORG 141 OP:PATTERN ---------------------------------------3-111---1--1-----------1----- -------------------------------------------------------------------------------11-----------------------------------------------------1----------------------------------------------------------------1------1---1------1-----------------------------------1-1-11-1-----1111-1-11111111111111111111111111111111111111111111111111---3111111111211-11211111----11----1---11-------11---------------1--------------------------1------------------------------------------------------------------------------------------1111---111----11111-11----1----1----------------------------------1--1-1--1-11---------11----------------------------------------------------1-----1-----1-----------------------------------------------------------------------------------------------------------------------------------------------------1-----1-------------11------11-11----------------------------------1-------------------------------1------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 143 STR:RPRED 99.3 SQ:SECSTR #HHHHHHHHHHHHHHHHHHHHHHHTGGGGGHTccHHHHHHHHHHHHcTTccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHHTTTccHHHHHHHHHHHHHHHHHHHHcH DISOP:02AL 1-1,142-145| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEcHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHcc //