[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : fabZ
DDBJ      :fabZ         (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase
Swiss-Prot:FABZ_STRZT   RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase;         Short=(3R)-hydroxymyristoyl ACP dehydrase;         EC=4.2.1.-;

Homologs  Archaea  0/68 : Bacteria  782/915 : Eukaryota  24/199 : Viruses  0/175   --->[See Alignment]
d.38.1
:140 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->138 1z6bF PDBj 8e-31 50.7 %
:RPS:PDB   2->138 3dozD PDBj 2e-31 47.4 %
:RPS:SCOP  3->137 1u1zA  d.38.1.6 * 9e-49 49.6 %
:HMM:SCOP  4->140 1mkaA_ d.38.1.2 * 3.9e-46 48.5 %
:RPS:PFM   11->130 PF07977 * FabA 2e-31 61.7 %
:HMM:PFM   11->131 PF07977 * FabA 3.3e-45 60.3 121/138  
:BLT:SWISS 1->140 FABZ_STRZT 2e-76 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55734.1 GT:GENE fabZ GT:PRODUCT (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 381285..381707 GB:FROM 381285 GB:TO 381707 GB:DIRECTION + GB:GENE fabZ GB:PRODUCT (3R)-hydroxymyristoyl-(acyl-carrier-protein) dehydratase GB:NOTE identified by match to protein family HMM PF07977; match to protein family HMM TIGR01750 GB:PROTEIN_ID ACF55734.1 GB:DB_XREF GI:194357286 GB:GENE:GENE fabZ LENGTH 140 SQ:AASEQ MIDIQGIKEALPHRYPMLLVDRVLEVSEDTIVAIKNVTINEPFFNGHFPQYPVMPGVLIMEALAQTAGVLELSKPENKGKLVFYAGMDKVKFKKQVVPGDQLVMTATFVKRRGTIAVVEAKAEVDGKLAASGILTFAIGN GT:EXON 1|1-140:0| SW:ID FABZ_STRZT SW:DE RecName: Full=(3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase; Short=(3R)-hydroxymyristoyl ACP dehydrase; EC=4.2.1.-; SW:GN Name=fabZ; OrderedLocusNames=SPT_0461; SW:KW Complete proteome; Cytoplasm; Lipid A biosynthesis; Lipid synthesis;Lyase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->140|FABZ_STRZT|2e-76|100.0|140/140| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009245|"GO:lipid A biosynthetic process"|Lipid A biosynthesis| GO:SWS GO:0008610|"GO:lipid biosynthetic process"|Lipid synthesis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| BL:PDB:NREP 1 BL:PDB:REP 2->138|1z6bF|8e-31|50.7|134/142| RP:PDB:NREP 1 RP:PDB:REP 2->138|3dozD|2e-31|47.4|137/149| RP:PFM:NREP 1 RP:PFM:REP 11->130|PF07977|2e-31|61.7|120/127|FabA| HM:PFM:NREP 1 HM:PFM:REP 11->131|PF07977|3.3e-45|60.3|121/138|FabA| RP:SCP:NREP 1 RP:SCP:REP 3->137|1u1zA|9e-49|49.6|135/142|d.38.1.6| HM:SCP:REP 4->140|1mkaA_|3.9e-46|48.5|134/0|d.38.1.2|1/1|Thioesterase/thiol ester dehydrase-isomerase| OP:NHOMO 930 OP:NHOMOORG 806 OP:PATTERN -------------------------------------------------------------------- 1111------------------------------------------------1--------1---1-------------111111111111111111--112121121-11111111111111111111211111111111---11111111111111111111111111111111111111111111111111222222211221222121111122111211111111112111111111111111111112-222222-2-2222222222222222221111111111111111111111111111111111111111111111111111111111111111111--1211111111111111111111212111111111112222222222211111111111-22222222111121121222121122-111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111121111111111-1111112111111111111111111111111-2-121111111111111212112111131-11111111111111111111111111111111111111111111121111111111111-1111111111-11111111111111111-1111111111111111111111211111111111111111111211111111-12222221222211112222211111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111--------------1-1-------------------------1111111111121 11------1---------------------------------------------------------------------------------------------------2-------------------------------------------------------------2----1111A111113212-2111----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 139 STR:RPRED 99.3 SQ:SECSTR cccHHHHHHHccccTTcccccEEEEEETTEEEEEEEcccccGGGGcccTTcccccHHHHHHHHHHHHHHHHHHHHHHTTcEEEEEEEEEEEEcccccTTcEEEEEEEEEEEETTEEEEEEEEEETTEEEEEEEEEEEEc# DISOP:02AL 1-1| PSIPRED cccHHHHHHHccccccEEEEEEEEEEcccEEEEEEEccccccEEccccccccEEEEHHHHHHHHHHHHHHHHHcccccccEEEEEEEccEEEccEEccccEEEEEEEEEEEEccEEEEEEEEEEccEEEEEEEEEEEEcc //