[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : fba
DDBJ      :fba          fructose-bisphosphate aldolase
Swiss-Prot:ALF_STRR6    RecName: Full=Fructose-bisphosphate aldolase;         Short=FBP aldolase;         Short=FBPA;         EC=4.1.2.13;AltName: Full=Fructose-1,6-bisphosphate aldolase;

Homologs  Archaea  2/68 : Bacteria  649/915 : Eukaryota  96/199 : Viruses  0/175   --->[See Alignment]
c.1.10
:293 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->293 1rvgA PDBj 3e-47 42.5 %
:RPS:PDB   3->292 3c56A PDBj 1e-41 36.6 %
:RPS:SCOP  2->293 1gvfA  c.1.10.2 * 5e-81 38.1 %
:HMM:SCOP  1->293 1dosA_ c.1.10.2 * 4.1e-97 49.8 %
:RPS:PFM   4->292 PF01116 * F_bP_aldolase 1e-54 49.3 %
:HMM:PFM   4->293 PF01116 * F_bP_aldolase 7e-100 52.7 277/286  
:BLT:SWISS 1->293 ALF_STRR6 e-157 100.0 %
:PROS 74->87|PS00602|ALDOLASE_CLASS_II_1
:PROS 133->144|PS00806|ALDOLASE_CLASS_II_2
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56461.1 GT:GENE fba GT:PRODUCT fructose-bisphosphate aldolase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 533142..534023 GB:FROM 533142 GB:TO 534023 GB:DIRECTION + GB:GENE fba GB:PRODUCT fructose-bisphosphate aldolase GB:NOTE identified by match to protein family HMM PF01116; match to protein family HMM TIGR00167; match to protein family HMM TIGR01859 GB:PROTEIN_ID ACF56461.1 GB:DB_XREF GI:194358013 GB:GENE:GENE fba LENGTH 293 SQ:AASEQ MAIVSAEKFVQAARDNGYAVGGFNTNNLEWTQAILRAAEAKKAPVLIQTSMGAAKYMGGYKVARNLIANLVESMGITVPVAIHLDHGHYEDALECIEVGYTSIMFDGSHLPVEENLKLAKEVVEKAHAKGISVEAEVGTIGGEEDGIIGKGELAPIEDAKAMVETGIDFLAAGIGNIHGPYPVNWEGLDLDHLQKLTEALPGFPIVLHGGSGIPDEQIQAAIKLGVAKVNVNTECQIAFANATRKFARDYEANEAEYDKKKLFDPRKFLADGVKAIQASVEERIDVFGSEGKA GT:EXON 1|1-293:0| SW:ID ALF_STRR6 SW:DE RecName: Full=Fructose-bisphosphate aldolase; Short=FBP aldolase; Short=FBPA; EC=4.1.2.13;AltName: Full=Fructose-1,6-bisphosphate aldolase; SW:GN Name=fba; OrderedLocusNames=spr0530; SW:KW Complete proteome; Glycolysis; Lyase; Metal-binding; Zinc. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->293|ALF_STRR6|e-157|100.0|293/293| GO:SWS:NREP 3 GO:SWS GO:0006096|"GO:glycolysis"|Glycolysis| GO:SWS GO:0016829|"GO:lyase activity"|Lyase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 74->87|PS00602|ALDOLASE_CLASS_II_1|PDOC00523| PROS 133->144|PS00806|ALDOLASE_CLASS_II_2|PDOC00523| SEG 138->152|gtiggeedgiigkge| BL:PDB:NREP 1 BL:PDB:REP 3->293|1rvgA|3e-47|42.5|273/299| RP:PDB:NREP 1 RP:PDB:REP 3->292|3c56A|1e-41|36.6|273/297| RP:PFM:NREP 1 RP:PFM:REP 4->292|PF01116|1e-54|49.3|276/285|F_bP_aldolase| HM:PFM:NREP 1 HM:PFM:REP 4->293|PF01116|7e-100|52.7|277/286|F_bP_aldolase| GO:PFM:NREP 3 GO:PFM GO:0004332|"GO:fructose-bisphosphate aldolase activity"|PF01116|IPR000771| GO:PFM GO:0006096|"GO:glycolysis"|PF01116|IPR000771| GO:PFM GO:0008270|"GO:zinc ion binding"|PF01116|IPR000771| RP:SCP:NREP 1 RP:SCP:REP 2->293|1gvfA|5e-81|38.1|270/273|c.1.10.2| HM:SCP:REP 1->293|1dosA_|4.1e-97|49.8|291/358|c.1.10.2|1/1|Aldolase| OP:NHOMO 1130 OP:NHOMOORG 747 OP:PATTERN ----------------------------11-------------------------------------- -11-21-------11--11-11--13111111-1111112----211--112423112----11-22221-11111--2-1--1----111111---------11--2-----------------111111111-1----------1112111111111111111121111111-111-1-1-11111111-122222212412121117233222211222112444444211111111111111111111111-1381-111111177111---11111121111121111111111111111111111111411111111311222222222323141123321211121111221111211221121-1--11111------122421-1111111111111111-11111111-1--1-----211-22-1---111222211---------1--1-111-----------------------------------111111111111111111111111111122133111112211112112111111-1111111111111112-11--2111-11111---111-11-----1-1-----------11111111111-1-221-1-1-11-1-1111111111111111111--11111------2---22-3557376733-5323655373574333332323221112122222222312123322222211--22222212222---111111----21111-------------11111111111-1-111111211111111111111111111-113--------11--------------1112---------------1111111-1-211112221211211111111112111111 -----------1--132333222636222-111222122222222222222154213113221111111111-2111-1111111-2--112222221221-1-----------------------------------------------------------------------------111--113121122----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 293 STR:RPRED 100.0 SQ:SECSTR cHcccHHHHHHHHHHHTccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEHHHHHHHcHHHHHHHHHHHHHHHccTTccEEEEEEEEccHHHHHHHHHTccEEEEccTTccHHHHHHHHHHHHHHHHHTTcEEEEEEcccccccccccccccccHHHHHHHHHHHcccEEEEcccccccccccccccccHHHHHHHHHHHHHTTccccccccccHHHHHHHHHHTEEEEEEcHHHHHHHHHHHHHHHHHcHHcEEEEHcTTcccHHHHHHHHHHHHHHHHHHHHHHHTcTTcc DISOP:02AL 292-294| PSIPRED cccccHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHcccEEEEEcHHHHHHcccHHHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHccccEEEEccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEcccccccccccccccHHHHHHHHHHcccEEEEEccccccccccccccccHHHHHHHHHHHccccEEEEccccccHHHHHHHHHcccEEEEEcHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccc //