[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : fmt
DDBJ      :fmt          methionyl-tRNA formyltransferase
Swiss-Prot:FMT_STRP4    RecName: Full=Methionyl-tRNA formyltransferase;         EC=2.1.2.9;

Homologs  Archaea  2/68 : Bacteria  900/915 : Eukaryota  173/199 : Viruses  0/175   --->[See Alignment]
b.46.1c.65.1
:311 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->308 2fmtA PDBj 8e-61 41.6 %
:RPS:PDB   3->296 2cfiA PDBj 4e-73 24.2 %
:RPS:SCOP  52->202 1zghA2  c.65.1.1 * 8e-40 20.0 %
:RPS:SCOP  205->309 1fmtA1  b.46.1.1 * 1e-32 35.2 %
:HMM:SCOP  2->207 2blnA2 c.65.1.1 * 5.4e-59 37.6 %
:HMM:SCOP  205->306 1fmtA1 b.46.1.1 * 6.4e-29 46.1 %
:RPS:PFM   27->181 PF00551 * Formyl_trans_N 1e-22 36.8 %
:RPS:PFM   205->298 PF02911 * Formyl_trans_C 1e-19 45.7 %
:HMM:PFM   3->178 PF00551 * Formyl_trans_N 3.4e-40 33.5 173/181  
:HMM:PFM   204->299 PF02911 * Formyl_trans_C 7.1e-33 40.6 96/100  
:BLT:SWISS 1->311 FMT_STRP4 e-179 100.0 %
:PROS 133->156|PS00373|GART

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56411.1 GT:GENE fmt GT:PRODUCT methionyl-tRNA formyltransferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1587148..1588083) GB:FROM 1587148 GB:TO 1588083 GB:DIRECTION - GB:GENE fmt GB:PRODUCT methionyl-tRNA formyltransferase GB:NOTE identified by match to protein family HMM PF00551; match to protein family HMM PF02911; match to protein family HMM TIGR00460 GB:PROTEIN_ID ACF56411.1 GB:DB_XREF GI:194357963 GB:GENE:GENE fmt LENGTH 311 SQ:AASEQ MTKLIFMGTPDFSATVLKGLLTDDRYEILAVVTQPDRAVGRKKVIQETPVKQAAKEAGLSIYQPEKLSGSPEMEELMKLGADGIVTAAFGQFLPSKLLDSMDFAVNVHASLLPRHRGGAPIHYALIQGDEEAGVTIMEMVKEMDAGDMISRRSIPITDEDNVGTLFEKLALVGRDLLLDTLPAYIAGDIKPEPQDTSQVTFSPNIKPEEEKLDWNKTNRQLFNQIRGMNPWPVAHTFLKGDRFKIYEALPVEGQGNPGEILSICKKELIVATAEGALSLKQVQPAGKPKMDIASFLNGVGRTLTVGERFGD GT:EXON 1|1-311:0| SW:ID FMT_STRP4 SW:DE RecName: Full=Methionyl-tRNA formyltransferase; EC=2.1.2.9; SW:GN Name=fmt; OrderedLocusNames=SPG_1641; SW:KW Complete proteome; Methyltransferase; Protein biosynthesis;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->311|FMT_STRP4|e-179|100.0|311/311| GO:SWS:NREP 3 GO:SWS GO:0008168|"GO:methyltransferase activity"|Methyltransferase| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 133->156|PS00373|GART|PDOC00319| BL:PDB:NREP 1 BL:PDB:REP 3->308|2fmtA|8e-61|41.6|305/314| RP:PDB:NREP 1 RP:PDB:REP 3->296|2cfiA|4e-73|24.2|285/310| RP:PFM:NREP 2 RP:PFM:REP 27->181|PF00551|1e-22|36.8|152/179|Formyl_trans_N| RP:PFM:REP 205->298|PF02911|1e-19|45.7|94/100|Formyl_trans_C| HM:PFM:NREP 2 HM:PFM:REP 3->178|PF00551|3.4e-40|33.5|173/181|Formyl_trans_N| HM:PFM:REP 204->299|PF02911|7.1e-33|40.6|96/100|Formyl_trans_C| GO:PFM:NREP 4 GO:PFM GO:0009058|"GO:biosynthetic process"|PF00551|IPR002376| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF00551|IPR002376| GO:PFM GO:0009058|"GO:biosynthetic process"|PF02911|IPR005793| GO:PFM GO:0016742|"GO:hydroxymethyl-, formyl- and related transferase activity"|PF02911|IPR005793| RP:SCP:NREP 2 RP:SCP:REP 52->202|1zghA2|8e-40|20.0|145/164|c.65.1.1| RP:SCP:REP 205->309|1fmtA1|1e-32|35.2|105/108|b.46.1.1| HM:SCP:REP 2->207|2blnA2|5.4e-59|37.6|202/0|c.65.1.1|1/1|Formyltransferase| HM:SCP:REP 205->306|1fmtA1|6.4e-29|46.1|102/108|b.46.1.1|1/1|FMT C-terminal domain-like| OP:NHOMO 1403 OP:NHOMOORG 1075 OP:PATTERN ---------------------------------------------1-1-------------------- 1111121111121221111-11111211111111111222111211111111111111111211222122111111111111221111211111111--1121111112211111111111111111111111121111111111111111111111211111111111111111111111111111111111111111212112111211111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112211111111121211111111111111211111111111111111111111111211111111111111111111-22222213111111111121112211121111111112111111111111111111111111111111111111111111111111111112411222222222222222122222222222223222111111111111121111411111111111111121112111212211221221221111112111211111111211111111111111112213131111221111111111111111211-1111111111111222222222222222-222222222222222222222222232212222222222222122222222222222222222221121111111111111111111111111111111111111111112222122221111112211121111111111111111111111111111112222111111111111111111111----1-111-111---1111111111111111111121 ----12--2-1-111111111-1111-11-111111111111111111112-1--1--111111111111111111111111111111--1111111111--1111-11142333312112331321628H3-456122132243-32213125222232122322-32221141122-71111111111111121-11 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 309 STR:RPRED 99.4 SQ:SECSTR cEEEEEEccHHHHHHHHHHHHTHTTcEEEEEEEcccccccccHcccccHHHHHHHHHTccEEEccccEETTEHHHHHHTcccEEEEccccccccHHHHTccTcEEEEEcccTTTTccccHHHHHHHTTccEEEEEEEEcccccccccEEEEEEEEccTTccHHHHHHHTTHHHHHHHHHHHHHHHTTcccccccccTTccccccccGGGGcccccccHHHHHHHHHTTTTTTcEEEEETTEEEEEEEEEccTTccccEEEETETTEEEEEcTTccEEEEEEEEcTTccEEEGGGTTHHHTGGccTTccc## DISOP:02AL 311-312| PSIPRED cEEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccccccccHHHHHHHHccccEEEccccccHHHHHHHHHccccEEEEccccccccHHHHHHcccEEEEccccccccccccHHHHHHHccccEEEEEEEEEccccccccEEEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccccccHHHHcccccccHHHHHHHHcccccccEEEEEEccEEEEEEEEEEccccccccEEEEEcccEEEEEccccEEEEEEEEccccccccHHHHHHcccccccccccccc //