[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : gatB
DDBJ      :gatB         Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit
Swiss-Prot:GATB_STRP4   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B;         Short=Asp/Glu-ADT subunit B;         EC=6.3.5.-;

Homologs  Archaea  63/68 : Bacteria  720/915 : Eukaryota  181/199 : Viruses  0/175   --->[See Alignment]
a.182.1d.128.1
:480 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->413 2g5iB PDBj e-147 63.4 %
:RPS:PDB   2->402 2df4B PDBj e-172 66.2 %
:RPS:SCOP  2->295 2df4B2  d.128.1.5 * e-138 70.2 %
:RPS:SCOP  296->402 2df4B1  a.182.1.2 * 5e-30 55.1 %
:HMM:SCOP  4->295 2f2aB2 d.128.1.5 * 1.5e-119 59.7 %
:HMM:SCOP  296->402 2f2aB1 a.182.1.2 * 1.8e-33 46.7 %
:RPS:PFM   6->290 PF02934 * GatB_N e-103 61.8 %
:RPS:PFM   328->465 PF02637 * GatB_Yqey 9e-30 47.8 %
:HMM:PFM   4->290 PF02934 * GatB_N 3.1e-121 53.3 287/289  
:HMM:PFM   327->474 PF02637 * GatB_Yqey 1.7e-47 42.6 148/149  
:BLT:SWISS 1->465 GATB_STRP4 0.0 100.0 %
:PROS 143->157|PS01234|GATB
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56666.1 GT:GENE gatB GT:PRODUCT Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(387402..388844) GB:FROM 387402 GB:TO 388844 GB:DIRECTION - GB:GENE gatB GB:PRODUCT Asp-tRNAAsn/Glu-tRNAGln amidotransferase B subunit GB:NOTE identified by match to protein family HMM PF01162; match to protein family HMM PF02637; match to protein family HMM PF02934; match to protein family HMM TIGR00133 GB:PROTEIN_ID ACF56666.1 GB:DB_XREF GI:194358218 GB:GENE:GENE gatB LENGTH 480 SQ:AASEQ MNFETVIGLEVHVELNTNSKIFSPTSAHFGNDQNANTNVIDWSFPGVLPVLNKGVVDAGIKAALALNMDIHKKMHFDRKNYFYPDNPKAYQISQFDEPIGYNGWIEVELEDGTTKKIGIERAHLEEDAGKNTHGTDGYSYVDLNRQGVPLIEIVSEADMRSPEEAYAYLTALKEVIQYAGISDVKMEEGSMRVDANISLRPYGQEKFGTKTELKNLNSFSNVRKGLEYEVQRQAEILRSGGQIRQETRRYDEANKATILMRVKEGAADYRYFPEPDXPLFEIXDEWIEEMRTELPEFPKERRARYVSDLGLSDYDASQLTANKVTSDFFEKAVALDGDAKQVSNWLQGEVAQFLNAEGKTLEQIELTPENLVEMIAIIEDGTISSKIAKKVFVHLAKNGGGAREYVEKAGMVQISDPAILIPIIHQVFADNEAAVVDFKSGKRNADKAFTGFLMKATKGQANPQVALKLLAQELAKLKEN GT:EXON 1|1-480:0| SW:ID GATB_STRP4 SW:DE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B; Short=Asp/Glu-ADT subunit B; EC=6.3.5.-; SW:GN Name=gatB; OrderedLocusNames=SPG_0399; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->465|GATB_STRP4|0.0|100.0|465/480| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 143->157|PS01234|GATB|PDOC00948| SEG 466->479|alkllaqelaklke| BL:PDB:NREP 1 BL:PDB:REP 2->413|2g5iB|e-147|63.4|410/410| RP:PDB:NREP 1 RP:PDB:REP 2->402|2df4B|e-172|66.2|399/399| RP:PFM:NREP 2 RP:PFM:REP 6->290|PF02934|e-103|61.8|285/288|GatB_N| RP:PFM:REP 328->465|PF02637|9e-30|47.8|138/148|GatB_Yqey| HM:PFM:NREP 2 HM:PFM:REP 4->290|PF02934|3.1e-121|53.3|287/289|GatB_N| HM:PFM:REP 327->474|PF02637|1.7e-47|42.6|148/149|GatB_Yqey| GO:PFM:NREP 4 GO:PFM GO:0006412|"GO:translation"|PF02934|IPR006075| GO:PFM GO:0016874|"GO:ligase activity"|PF02934|IPR006075| GO:PFM GO:0006412|"GO:translation"|PF02637|IPR018027| GO:PFM GO:0016884|"GO:carbon-nitrogen ligase activity, with glutamine as amido-N-donor"|PF02637|IPR018027| RP:SCP:NREP 2 RP:SCP:REP 2->295|2df4B2|e-138|70.2|292/292|d.128.1.5| RP:SCP:REP 296->402|2df4B1|5e-30|55.1|107/107|a.182.1.2| HM:SCP:REP 4->295|2f2aB2|1.5e-119|59.7|290/0|d.128.1.5|1/1|Glutamine synthetase/guanido kinase| HM:SCP:REP 296->402|2f2aB1|1.8e-33|46.7|107/0|a.182.1.2|1/1|GatB/YqeY motif| OP:NHOMO 1066 OP:NHOMOORG 964 OP:PATTERN 22121222222222221-111112211222212222222222211111122222-1-11-11-11212 1111111111111111111-1111111111111111111111111111111111111111111111111111111111-111111111--------1--------1112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-2111111111111-111---11211111122211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111122111111111111111111111111211----11--------------------------11111---------------------------------------------------------------------------------------------11111111111111---------------111111111111111111111111111111111111111----------------------------11111111111111111111-----1-11111111111111111111111111111111 11--111-1-----1111111111111111111111111111111111111111111-1111111111111111121-1111111112-1211111111-111111-1-1121112111111113-111181-1111111211211111111111111113111111111A11-11-12E2221111131421111112 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 464 STR:RPRED 96.7 SQ:SECSTR cccEEEEEEEEEEEccccccccccccccccccTTccccTTTTTcTTccccccHHHHHHHHHHHHTTTcEEccEEccEEEEcccTTcTTcEEEEccccccEEEEEEEEEcccccEEEEEEEEEEEEEcccEEEccTTTccEEETTcTTcEEEEEEEcTTcccHHHHHHHHHHHHHHHHHHTcccccTTTTcEEEEEEEEEEcTTccccccEEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcTTTccEEEEEEcccccccccEEcTTcccEEccHHHHHHHHHTccccHHHHHTTTTcTTccccHHHHHHcccHHHHHHHHHHHHHTccHHHHHHHHHTTHHHHHHHHTcccTTTcccHHHHHHHHHHHHTTcccGGGHHHHHHHHHHcccccTTHHHTTccccccHHHHHHHHHTTcTTTcccHHHHHTTTTHHHHHHHHHHHTTcccccGGGH################ DISOP:02AL 478-481| PSIPRED ccccEEEEEEEEEEEccccccccccccccccccccccccEEcccccccccccHHHHHHHHHHHHHHccEEccEEEEEEEEEEccccccccHHccccccEEcccEEEEEEccccEEEEEEEEEEEcccccccccccccEEEEEEccccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEEccccccccccEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHcccccccccEEEccccccccccccccccccccEEEcHHHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHccEEcccHHHHHHHHHHHHHccHHHHHHHHcccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcc //