[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : gatC
DDBJ      :gatC         Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit
Swiss-Prot:GATC_STRP4   RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C;         Short=Asp/Glu-ADT subunit C;         EC=6.3.5.-;

Homologs  Archaea  3/68 : Bacteria  242/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.137.12
:100 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->96 2g5hC PDBj 2e-16 38.9 %
:RPS:PDB   2->97 2dqnC PDBj 4e-26 38.5 %
:RPS:SCOP  2->97 2df4C1  a.137.12.1 * 3e-26 38.5 %
:HMM:SCOP  2->93 2f2aC1 a.137.12.1 * 2.3e-28 43.5 %
:RPS:PFM   20->90 PF02686 * Glu-tRNAGln 2e-07 40.8 %
:HMM:PFM   19->90 PF02686 * Glu-tRNAGln 1.2e-25 41.7 72/72  
:BLT:SWISS 1->100 GATC_STRP4 3e-53 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55264.1 GT:GENE gatC GT:PRODUCT Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(390310..390612) GB:FROM 390310 GB:TO 390612 GB:DIRECTION - GB:GENE gatC GB:PRODUCT Asp-tRNAAsn/Glu-tRNAGln amidotransferase C subunit GB:NOTE identified by match to protein family HMM PF02686; match to protein family HMM TIGR00135 GB:PROTEIN_ID ACF55264.1 GB:DB_XREF GI:194356816 GB:GENE:GENE gatC LENGTH 100 SQ:AASEQ MKITQEEVTHVANLSKLRFSEKETAAFATTLSKIVDMVELLGEVDTTGVAPTTTMADRKTVLRPDVAEEGTDRDRLFKNVPKKDNYYIKVPAILDDGGDA GT:EXON 1|1-100:0| SW:ID GATC_STRP4 SW:DE RecName: Full=Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C; Short=Asp/Glu-ADT subunit C; EC=6.3.5.-; SW:GN Name=gatC; OrderedLocusNames=SPG_0401; SW:KW ATP-binding; Complete proteome; Ligase; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->100|GATC_STRP4|3e-53|100.0|100/100| GO:SWS:NREP 4 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 2->96|2g5hC|2e-16|38.9|95/99| RP:PDB:NREP 1 RP:PDB:REP 2->97|2dqnC|4e-26|38.5|96/98| RP:PFM:NREP 1 RP:PFM:REP 20->90|PF02686|2e-07|40.8|71/72|Glu-tRNAGln| HM:PFM:NREP 1 HM:PFM:REP 19->90|PF02686|1.2e-25|41.7|72/72|Glu-tRNAGln| GO:PFM:NREP 1 GO:PFM GO:0006450|"GO:regulation of translational fidelity"|PF02686|IPR003837| RP:SCP:NREP 1 RP:SCP:REP 2->97|2df4C1|3e-26|38.5|96/99|a.137.12.1| HM:SCP:REP 2->93|2f2aC1|2.3e-28|43.5|92/0|a.137.12.1|1/1|Glu-tRNAGln amidotransferase C subunit| OP:NHOMO 246 OP:NHOMOORG 245 OP:PATTERN ------------------------------------------------11--1--------------- -11---------------------------------------------------------------1------------------1-------------------1111----------------11111111111111111111-111111---11---1-111111111-111-111-11---------1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1---------------------------11111--111111111--1-1---------------------------------------------1----------------1---11111-1------------1--11--------------11--11---------1111--------------------------------------------------------------------------1--11-11-1-------1-111-----1------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11------------------------------------------------------------1------------------------------------------------1-1-1--1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 96 STR:RPRED 96.0 SQ:SECSTR #cccHHHHHHHHHHHTccccHHHHHHHHHHHHHHHHHHGGGGGcccTTccccccccccccccccccccccccHHHHHTTcccccccccccccccccc### DISOP:02AL 1-1,96-101| PSIPRED ccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccHHHHHHHcHHHcccEEEEEEEEcccccc //