[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : glyA
DDBJ      :glyA         serine hydroxymethyltransferase
Swiss-Prot:GLYA_STRZJ   RecName: Full=Serine hydroxymethyltransferase;         Short=Serine methylase;         Short=SHMT;         EC=2.1.2.1;

Homologs  Archaea  61/68 : Bacteria  896/915 : Eukaryota  191/199 : Viruses  1/175   --->[See Alignment]
c.67.1
:418 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   18->411 1kkjA PDBj e-133 61.2 %
:RPS:PDB   15->416 1cj0A PDBj 5e-65 41.8 %
:RPS:SCOP  15->416 1bj4A  c.67.1.4 * e-125 41.5 %
:HMM:SCOP  1->416 2a7vA1 c.67.1.4 * 4.6e-168 58.5 %
:RPS:PFM   18->386 PF00464 * SHMT e-140 64.7 %
:HMM:PFM   9->386 PF00464 * SHMT 5.2e-173 60.9 376/399  
:BLT:SWISS 15->418 GLYA_STRZJ 0.0 99.8 %
:PROS 222->238|PS00096|SHMT
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55081.1 GT:GENE glyA GT:PRODUCT serine hydroxymethyltransferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 912537..913793 GB:FROM 912537 GB:TO 913793 GB:DIRECTION + GB:GENE glyA GB:PRODUCT serine hydroxymethyltransferase GB:NOTE identified by match to protein family HMM PF00155; match to protein family HMM PF00464; match to protein family HMM PF01212 GB:PROTEIN_ID ACF55081.1 GB:DB_XREF GI:194356633 GB:GENE:GENE glyA LENGTH 418 SQ:AASEQ MIFDKDDFKAYDADLWNAIAKEEERQQNNIELIASENVVSKAVMAAQGSILTNKYAEGYPGRRYYGGTDVVDVVETLAIERAKEIFGAKFANVQPHSGSQANCAAYMSLIEPGDTVMGMDLASGGHLTHGAPVSFSGQTYNFVSYSVDPETELLDFDAILKQAQEVKPKLIVAGASAYSQIIDFSKFREIADAVGAKLMVDMAHIAGLVAAGLHPSPVPYAHITTTTTHKTLRGPRGGLILTNDEELAKKINSAIFPGIQGGPLXHVVAAKAVSFKEVLDPAFKEYAANVIKNSKAMADVFLQDPDFRIISGGTENHLFLVDVTKVVENGKVAQNLLDEVNITLNKNSIPYESLSPFKTSGIRIGAAAITARGFGEEESRKVAELIIKTLKNSENEAVLEEVRSAVKELTDAFLLYED GT:EXON 1|1-418:0| SW:ID GLYA_STRZJ SW:DE RecName: Full=Serine hydroxymethyltransferase; Short=Serine methylase; Short=SHMT; EC=2.1.2.1; SW:GN Name=glyA; OrderedLocusNames=SPJ_0963; SW:KW Complete proteome; Cytoplasm; One-carbon metabolism;Pyridoxal phosphate; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 15->418|GLYA_STRZJ|0.0|99.8|404/418| GO:SWS:NREP 3 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 222->238|PS00096|SHMT|PDOC00090| SEG 3->14|fdkddfkaydad| SEG 224->228|ttttt| SEG 361->375|girigaaaitargfg| BL:PDB:NREP 1 BL:PDB:REP 18->411|1kkjA|e-133|61.2|392/405| RP:PDB:NREP 1 RP:PDB:REP 15->416|1cj0A|5e-65|41.8|400/464| RP:PFM:NREP 1 RP:PFM:REP 18->386|PF00464|e-140|64.7|368/378|SHMT| HM:PFM:NREP 1 HM:PFM:REP 9->386|PF00464|5.2e-173|60.9|376/399|SHMT| GO:PFM:NREP 3 GO:PFM GO:0004372|"GO:glycine hydroxymethyltransferase activity"|PF00464|IPR001085| GO:PFM GO:0006544|"GO:glycine metabolic process"|PF00464|IPR001085| GO:PFM GO:0006563|"GO:L-serine metabolic process"|PF00464|IPR001085| RP:SCP:NREP 1 RP:SCP:REP 15->416|1bj4A|e-125|41.5|400/470|c.67.1.4| HM:SCP:REP 1->416|2a7vA1|4.6e-168|58.5|414/0|c.67.1.4|1/1|PLP-dependent transferases| OP:NHOMO 1670 OP:NHOMOORG 1149 OP:PATTERN 1111111111111111-111111111121211111111-----1111111111111111112221-11 1111111111111111122-2111212222221111124412221111111133311211111112233311---111-111211111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111-11-11-111111111111111111111111111111111111111111111111111111111111121111111111111121111111-11111111111111111111111-11111111111111121111121211111211111111112114112221122212111222221112211111313111111111111111211111111111111111111111111111111111122113222242222222352222123421211111121211131112111111111111111111111111111111112211111111111111111211121111111111111111111211111111111141111111112111111111111111111121111-111111111111111111-11111111111111111121112211111212121111212111111111111111111111111111111111111111211111111-11111111111111111111333333323232213221111111111111222222222221111111111111111111111111111111111111111-1111111111111111---1111111111111 1122222-52--22222222222222222222222222222222222222333322222222221222222122222-2222222222-1212111111111122222524324321222122223272AY3-638222222221-2222211121223333223222124-2223333s3333275DB2943332223 -----------------------------------1------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 404 STR:RPRED 96.7 SQ:SECSTR ##############HHHHHHHHHHHHHHcEEccTTcccccHHHHHHTTcGGGGcccccccccccccccTTHHHHHHHHHHHHHHHTTccTEEcccccHHHHHHHHHHHHccTTcEEEEEcTTTTccGGGcccccHHHHHcEEEEEcccTTTccccHHHHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHTcEEEEEcTTTHHHHHHTccccGGGTccEEEEEccccccccccEEEEEEcccHHHHHHHHHTTTTcccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHTTTcEETTccccccEEEEEGGGGTccHHHHHHHHHHTTEEcEEEccTTccccTTcccEEEEEcHHHHTTTccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHcccccc DISOP:02AL 1-5,418-419| PSIPRED cccccccHHHHcHHHHHHHHHHHHHHHcccEEEEccccccHHHHHHHHHHHHccHHcccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHccccEEEEcccccccccccHHHHHHHcccccccEEEEccccccccccHHHHHHHHHHcccEEEEEccHHcccHHccccccccccccEEEccccccccccccEEEEEccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccEEcccccccEEEEEEEEcccccHHHHHHHHHHcccEEccccccccccccccccccccccHHHHHccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccc //