[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : glyQ
DDBJ      :glyQ         glycyl-tRNA synthetase alpha chain
Swiss-Prot:SYGA_STRP4   RecName: Full=Glycyl-tRNA synthetase alpha subunit;         EC=6.1.1.14;AltName: Full=Glycine--tRNA ligase alpha subunit;         Short=GlyRS;

Homologs  Archaea  0/68 : Bacteria  671/915 : Eukaryota  17/199 : Viruses  0/175   --->[See Alignment]
d.104.1
:305 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->280 1j5wB PDBj 3e-85 55.3 %
:RPS:PDB   110->294 2du7A PDBj 4e-15 14.7 %
:RPS:SCOP  7->284 1j5wA  d.104.1.1 * e-136 56.4 %
:HMM:SCOP  5->285 1j5wA_ d.104.1.1 * 2.1e-136 65.5 %
:RPS:PFM   7->289 PF02091 * tRNA-synt_2e e-125 70.7 %
:HMM:PFM   7->290 PF02091 * tRNA-synt_2e 2.7e-153 68.0 284/284  
:BLT:SWISS 1->305 SYGA_STRP4 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55085.1 GT:GENE glyQ GT:PRODUCT glycyl-tRNA synthetase alpha chain GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1357837..1358754) GB:FROM 1357837 GB:TO 1358754 GB:DIRECTION - GB:GENE glyQ GB:PRODUCT glycyl-tRNA synthetase alpha chain GB:NOTE identified by match to protein family HMM PF02091; match to protein family HMM TIGR00388 GB:PROTEIN_ID ACF55085.1 GB:DB_XREF GI:194356637 GB:GENE:GENE glyQ LENGTH 305 SQ:AASEQ MSKKLTFQEIILTLQQFWNDQGCMLMQAYDNEKGAGTMSPYTFLRAIGPEPWNAAYVEPSRRPADGRYGENPNRLYQHHQFQVVMKPSPSNIQELYLESLEKLGINPLEHDIRFVEDNWENPSTGSAGLGWEVWLDGMEITQFTYFQQVGGLATSPVTAEVTYGLERLASYIQEVDSVYDIEWADGVKYGEIFIQPEYEHSKYSFEISDQEMLLENFDKFEKEAGRALEEGLVHPAYDYVLKCSHTFNLLDARGAVSVTERAGYIARIRNLARVVAKTFVAERKRLGYPLLDEETRAKLLAEDAE GT:EXON 1|1-305:0| SW:ID SYGA_STRP4 SW:DE RecName: Full=Glycyl-tRNA synthetase alpha subunit; EC=6.1.1.14;AltName: Full=Glycine--tRNA ligase alpha subunit; Short=GlyRS; SW:GN Name=glyQ; OrderedLocusNames=SPG_1403; SW:KW Aminoacyl-tRNA synthetase; ATP-binding; Complete proteome; Cytoplasm;Ligase; Nucleotide-binding; Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->305|SYGA_STRP4|0.0|100.0|305/305| GO:SWS:NREP 6 GO:SWS GO:0004812|"GO:aminoacyl-tRNA ligase activity"|Aminoacyl-tRNA synthetase| GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| BL:PDB:NREP 1 BL:PDB:REP 11->280|1j5wB|3e-85|55.3|264/272| RP:PDB:NREP 1 RP:PDB:REP 110->294|2du7A|4e-15|14.7|170/539| RP:PFM:NREP 1 RP:PFM:REP 7->289|PF02091|e-125|70.7|283/284|tRNA-synt_2e| HM:PFM:NREP 1 HM:PFM:REP 7->290|PF02091|2.7e-153|68.0|284/284|tRNA-synt_2e| GO:PFM:NREP 6 GO:PFM GO:0000166|"GO:nucleotide binding"|PF02091|IPR002310| GO:PFM GO:0004820|"GO:glycine-tRNA ligase activity"|PF02091|IPR002310| GO:PFM GO:0005524|"GO:ATP binding"|PF02091|IPR002310| GO:PFM GO:0005737|"GO:cytoplasm"|PF02091|IPR002310| GO:PFM GO:0006412|"GO:translation"|PF02091|IPR002310| GO:PFM GO:0006426|"GO:glycyl-tRNA aminoacylation"|PF02091|IPR002310| RP:SCP:NREP 1 RP:SCP:REP 7->284|1j5wA|e-136|56.4|273/276|d.104.1.1| HM:SCP:REP 5->285|1j5wA_|2.1e-136|65.5|281/281|d.104.1.1|1/1|Class II aaRS and biotin synthetases| OP:NHOMO 699 OP:NHOMOORG 688 OP:PATTERN -------------------------------------------------------------------- 111--------------------------------------111--------------111---1-------------1111-11111----------------------111111111111111---------------------1112111111111111111111111111111111111-----111--1---------------111111-------11111111111--------------------1111111111111111111111111111111111111111111111111111111111111111111111----------------1---------1-1--111111111111----111-1-111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-1111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111------------------------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1------2----11117111111111-2-------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 283 STR:RPRED 92.8 SQ:SECSTR ##########HHHHHHHHHTTTcEEccccc#ccccGGGcHHHHTGGGccccEEEEEEEEEEcGGGccTTcccccccEEEEEEEEEEcccTTHHHHHHHHHHHHTccTTccTTTcEEEEEccccccccEEEEEEEEEEEccHHHHHHEEcTTccccEEEEEEcHEHHHHHHHHTTccccHHHHccccccccccHHHHHHTTcccccccccHHHHHHHHHHHHHHccccccccccccccHHHHcccccccccccccEEccccccHHTTccccccccccccEEETTEEccccccccc########### DISOP:02AL 1-3,299-300,302-306| PSIPRED ccccccHHHHHHHHHHHHHHcccEEEEccccccccccccHHHHHHHcccccccccEEccccccccccccccccHHHHHEEEEEEEccccccHHHHHHHHHHHHcccHHHccccEEEccccccccccccccEEEEEccEEEEEEEEHHHcccccccccccccHHHHHHHHHHHcccccccccEEcccccEEEEEEcccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcc //