[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : hprK
DDBJ      :hprK         HPr(Ser) kinase/phosphatase
Swiss-Prot:HPRK_STRP4   RecName: Full=HPr kinase/phosphorylase;         Short=HPrK/P;         EC=2.7.11.-;         EC=2.7.4.-;AltName: Full=HPr(Ser) kinase/phosphorylase;

Homologs  Archaea  0/68 : Bacteria  323/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
c.91.1c.98.2
:311 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->299 1ko7A PDBj 5e-65 46.4 %
:RPS:PDB   60->120 3cf2A PDBj 1e-04 13.8 %
:RPS:PDB   146->248 2cnbB PDBj 2e-04 13.1 %
:RPS:SCOP  3->132 2iojA1  c.98.2.2 * 4e-18 15.4 %
:RPS:SCOP  133->303 1jb1A  c.91.1.2 * 3e-06 57.2 %
:HMM:SCOP  2->131 1ko7A1 c.98.2.1 * 1.8e-39 45.0 %
:HMM:SCOP  132->300 1ko7A2 c.91.1.2 * 2.4e-40 34.9 %
:RPS:PFM   2->127 PF02603 * Hpr_kinase_N 4e-28 53.6 %
:RPS:PFM   134->283 PF07475 * Hpr_kinase_C 7e-47 59.1 %
:HMM:PFM   130->298 PF07475 * Hpr_kinase_C 3.7e-73 56.2 169/171  
:HMM:PFM   1->128 PF02603 * Hpr_kinase_N 1.3e-46 51.2 127/127  
:BLT:SWISS 1->311 HPRK_STRP4 e-174 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55224.1 GT:GENE hprK GT:PRODUCT HPr(Ser) kinase/phosphatase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1316662..1317597) GB:FROM 1316662 GB:TO 1317597 GB:DIRECTION - GB:GENE hprK GB:PRODUCT HPr(Ser) kinase/phosphatase GB:NOTE identified by match to protein family HMM PF02603; match to protein family HMM PF07475; match to protein family HMM TIGR00679 GB:PROTEIN_ID ACF55224.1 GB:DB_XREF GI:194356776 GB:GENE:GENE hprK LENGTH 311 SQ:AASEQ MSVLVKEVIEKLRLDIVYGEPELLEKEINTADITRPGLEMTGYFDYYTPERIQLLGMKEWSYLISMPSNSRYEVLKKMFLPETPAVIVARGLVVPEEMLKAARECKIAILTSRAATSRLSGKLSSYLDSRLAERTSVHGVLMDIYGMGVLIQGDSGIGKSETGLELVKRGHRLVADDRVDIFAKDEITLWGEPAEILKHLIEIRGVGIIDVMSLYGASAVKDSSQVQLAVYLENYDTHKTFDRLGNNAEELEVSGVAIPRIRIPVKTGRNISVVIEAAAMNYRAKEMGFDATRLFDERLTSLIARNEVQNA GT:EXON 1|1-311:0| SW:ID HPRK_STRP4 SW:DE RecName: Full=HPr kinase/phosphorylase; Short=HPrK/P; EC=2.7.11.-; EC=2.7.4.-;AltName: Full=HPr(Ser) kinase/phosphorylase; SW:GN Name=hprK; OrderedLocusNames=SPG_1354; SW:KW ATP-binding; Carbohydrate metabolism; Complete proteome; Kinase;Magnesium; Metal-binding; Multifunctional enzyme; Nucleotide-binding;Serine/threonine-protein kinase; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->311|HPRK_STRP4|e-174|100.0|311/311| GO:SWS:NREP 8 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0003824|"GO:catalytic activity"|Multifunctional enzyme| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0004674|"GO:protein serine/threonine kinase activity"|Serine/threonine-protein kinase| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 6->299|1ko7A|5e-65|46.4|278/285| RP:PDB:NREP 2 RP:PDB:REP 60->120|3cf2A|1e-04|13.8|58/659| RP:PDB:REP 146->248|2cnbB|2e-04|13.1|99/363| RP:PFM:NREP 2 RP:PFM:REP 2->127|PF02603|4e-28|53.6|125/127|Hpr_kinase_N| RP:PFM:REP 134->283|PF07475|7e-47|59.1|149/157|Hpr_kinase_C| HM:PFM:NREP 2 HM:PFM:REP 130->298|PF07475|3.7e-73|56.2|169/171|Hpr_kinase_C| HM:PFM:REP 1->128|PF02603|1.3e-46|51.2|127/127|Hpr_kinase_N| GO:PFM:NREP 10 GO:PFM GO:0000155|"GO:two-component sensor activity"|PF02603|IPR011126| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF02603|IPR011126| GO:PFM GO:0004672|"GO:protein kinase activity"|PF02603|IPR011126| GO:PFM GO:0005524|"GO:ATP binding"|PF02603|IPR011126| GO:PFM GO:0006109|"GO:regulation of carbohydrate metabolic process"|PF02603|IPR011126| GO:PFM GO:0000155|"GO:two-component sensor activity"|PF07475|IPR011104| GO:PFM GO:0000160|"GO:two-component signal transduction system (phosphorelay)"|PF07475|IPR011104| GO:PFM GO:0004672|"GO:protein kinase activity"|PF07475|IPR011104| GO:PFM GO:0005524|"GO:ATP binding"|PF07475|IPR011104| GO:PFM GO:0006109|"GO:regulation of carbohydrate metabolic process"|PF07475|IPR011104| RP:SCP:NREP 2 RP:SCP:REP 3->132|2iojA1|4e-18|15.4|117/120|c.98.2.2| RP:SCP:REP 133->303|1jb1A|3e-06|57.2|159/161|c.91.1.2| HM:SCP:REP 2->131|1ko7A1|1.8e-39|45.0|129/129|c.98.2.1|1/1|HPr kinase/phoshatase HprK N-terminal domain| HM:SCP:REP 132->300|1ko7A2|2.4e-40|34.9|169/0|c.91.1.2|1/1|PEP carboxykinase-like| OP:NHOMO 326 OP:NHOMOORG 325 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------1---------------111111111111------------------------------------------------------111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111-11--------1---1111-1-1---11-------------------------------------------------------------------11--------------------------------------------------1-11111111111111111111111111111111111111111111111111111111111111111111111---------------1111111-11111111--------------------------11---------------------------------1-11---------------------------------------------------------------------------------------------11111-----------------------------------------------------------------------------11111111111111---1111111---------11----1-1-1-111---11111-111----------111 -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 305 STR:RPRED 98.1 SQ:SECSTR ##EEHHHHHHHHTcEEEEcGGGTcTcccccccEEccHHHHTTccTTccTTcEEEEcHHHTTcccEEEccHHHHTTTTTccccccccHHHTTcHHHHHHHHHHHHHHccccccTTTcccccHHHHHHHHHHTcEEEEEEcEEEEETccEEEEETTcHHHHHHHHHHHHHHcccEEEEEEccEcTTTTTccTTcccHHHHHHHHHHccccccTTcccccEEEEccTTcHHHHEHHHHHHTccccEEEEcccEEEETTEEEEEEEEEccccccHHHHHHHHHHHHHHHHTTccHHHHHHHHHHHHHHHHH#### DISOP:02AL 301-312| PSIPRED ccEEHHHHHHHccEEEEEccccccccEEEcccccccHHHHHcccccccccEEEEEcHHHHHHHHcccHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHHHHccEEEEEEEEEEEccEEEEEEccccccHHHHHHHHHHccccEEcccEEEEEEccccEEEEEEcHHHcccEEEEEEEEEEHHHHccccccccccEEEEEEEEcccccccccccccccHHHEEEccccccEEEEEccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcc //