[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ispA
DDBJ      :ispA         geranyltranstransferase
Swiss-Prot:             

Homologs  Archaea  65/68 : Bacteria  866/915 : Eukaryota  154/199 : Viruses  0/175   --->[See Alignment]
a.128.1
:291 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   25->285 1rtrA PDBj 3e-50 45.3 %
:RPS:PDB   5->272 2azlA PDBj 1e-49 23.2 %
:RPS:SCOP  4->243 1rqiA  a.128.1.1 * 1e-53 41.4 %
:HMM:SCOP  1->286 1rqjA_ a.128.1.1 * 1.9e-77 40.0 %
:RPS:PFM   33->266 PF00348 * polyprenyl_synt 9e-41 47.2 %
:HMM:PFM   29->272 PF00348 * polyprenyl_synt 7.7e-74 46.7 240/260  
:BLT:SWISS 7->269 ISPA_MICLU 2e-64 50.8 %
:PROS 207->219|PS00444|POLYPRENYL_SYNTHET_2
:PROS 77->93|PS00723|POLYPRENYL_SYNTHET_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54914.1 GT:GENE ispA GT:PRODUCT geranyltranstransferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1075678..1076553) GB:FROM 1075678 GB:TO 1076553 GB:DIRECTION - GB:GENE ispA GB:PRODUCT geranyltranstransferase GB:NOTE identified by match to protein family HMM PF00348 GB:PROTEIN_ID ACF54914.1 GB:DB_XREF GI:194356466 GB:GENE:GENE ispA LENGTH 291 SQ:AASEQ MKKQEKLALVESALEDFYGDQQFASSLRESVLYSIHAGGKRIRPFLLLEVLEALQVTIKPAHAQVATALEMIHTGSLIHDDLPAMDDDDYRRGRLTNHKKFGEAMAILAGDALFLDSYALIAQADLPSQIKVDLIANLSLASGSLGMVAGQVLDMEGEHQXLSLEELQTIHANKTGKLLAYPFQAAAIIAELSPEMQVKLKTVGELIGLAFQVRDDVLDVTASFEEIGKTPQKDLQAEKSTYPALLGLEESIAFCNQTLDQANEKLEEIAQQIPFETESIVSVVESLRING GT:EXON 1|1-291:0| BL:SWS:NREP 1 BL:SWS:REP 7->269|ISPA_MICLU|2e-64|50.8|260/291| PROS 207->219|PS00444|POLYPRENYL_SYNTHET_2|PDOC00407| PROS 77->93|PS00723|POLYPRENYL_SYNTHET_1|PDOC00407| BL:PDB:NREP 1 BL:PDB:REP 25->285|1rtrA|3e-50|45.3|245/277| RP:PDB:NREP 1 RP:PDB:REP 5->272|2azlA|1e-49|23.2|250/279| RP:PFM:NREP 1 RP:PFM:REP 33->266|PF00348|9e-41|47.2|229/246|polyprenyl_synt| HM:PFM:NREP 1 HM:PFM:REP 29->272|PF00348|7.7e-74|46.7|240/260|polyprenyl_synt| GO:PFM:NREP 1 GO:PFM GO:0008299|"GO:isoprenoid biosynthetic process"|PF00348|IPR000092| RP:SCP:NREP 1 RP:SCP:REP 4->243|1rqiA|1e-53|41.4|239/300|a.128.1.1| HM:SCP:REP 1->286|1rqjA_|1.9e-77|40.0|285/299|a.128.1.1|1/1|Terpenoid synthases| OP:NHOMO 2033 OP:NHOMOORG 1085 OP:PATTERN 1111111111111111-22222-221121212111111111111111122222111121112221-22 3222122333322122222-22115122222133331111111111-122211111111112125264231-111---1-11322222112222221112222222222111111111111111222222222222222221112222232222222222222222222222222222222222111111132222222222222222222222222222222223333332222222222222222222222312122122-23322331211233332222111111111111111111111111111111112111222211112-11111111121111111112112112233222222232121-21223322122222233432223333322222222222-33333233232222223332222223222332333332222222222222222332222222222111111111111111222222222222223222222222222222233312222222222222222222222222222222222222222222222322222212221122222222222222232222221122222221111111111111222222222222222222222222222222221-222321--11123222222222222222-2222222222222222222222222322222222222222222222222222222222222222212222222222222222222222222222222222222222223222222222222223222222222222222222222222222222222222222222221222222--------111-------------------------111-111122222 111111--521--1-1111111121211111111111111111111--11111-111111111-111-1-1-1-1---1-11----11-12111321111---1-1--212111112-1--11-1--11261-22-1---1-111111-11112-111211-1314-121-22223333j3333375AG1F63311114 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 285 STR:RPRED 97.9 SQ:SECSTR ##HHHHHHHHHHHHHccccHHHHHHHccHHHHTTcccccccHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHHHHHHHHHHHHHHTccEETTEEcHHHHTcHHHHHHHHHHHHHHHHHHHHHHTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTccccHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTTcccHHHHHHHHHHHHHHHHHHHHHHHHcTcccccTTcccccTTTTccHHHHHHHHHcHHHHHHHHTTcHHHHHHHHHHTcccHHHHHHHHHHH#### DISOP:02AL 1-1,291-292| PSIPRED ccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHccccHHHHHHHccccHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcc //