[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : lguL
DDBJ      :lguL         lactoylglutathione lyase
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  415/915 : Eukaryota  13/199 : Viruses  0/175   --->[See Alignment]
d.32.1
:126 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->125 1f9zA PDBj 3e-16 36.1 %
:RPS:PDB   3->123 2a4xA PDBj 2e-17 17.4 %
:RPS:SCOP  1->123 1sp9A  d.32.1.3 * 3e-17 13.0 %
:HMM:SCOP  1->124 1sp8A2 d.32.1.3 * 3e-32 31.5 %
:RPS:PFM   4->121 PF00903 * Glyoxalase 2e-07 28.9 %
:HMM:PFM   5->122 PF00903 * Glyoxalase 8e-23 26.3 118/128  
:BLT:SWISS 4->126 LGUL_NEIMB 1e-19 40.7 %
:PROS 7->28|PS00934|GLYOXALASE_I_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55889.1 GT:GENE lguL GT:PRODUCT lactoylglutathione lyase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 854728..855108 GB:FROM 854728 GB:TO 855108 GB:DIRECTION + GB:GENE lguL GB:PRODUCT lactoylglutathione lyase GB:NOTE identified by match to protein family HMM PF00903 GB:PROTEIN_ID ACF55889.1 GB:DB_XREF GI:194357441 GB:GENE:GENE lguL LENGTH 126 SQ:AASEQ MASKMLHTCLRVENLEKSIAFYQDAFGFKELRRRDFPDHAFTIVYLGLEGDDYELELTYNYDHGPYVVGDGFAHIALSTPDLEALHQEHSAKGYEVTEPNGLPGTTPNYYFVKDPDGYKVEVIREK GT:EXON 1|1-126:0| BL:SWS:NREP 1 BL:SWS:REP 4->126|LGUL_NEIMB|1e-19|40.7|123/138| PROS 7->28|PS00934|GLYOXALASE_I_1|PDOC00720| SEG 45->57|ylglegddyelel| BL:PDB:NREP 1 BL:PDB:REP 4->125|1f9zA|3e-16|36.1|122/128| RP:PDB:NREP 1 RP:PDB:REP 3->123|2a4xA|2e-17|17.4|121/131| RP:PFM:NREP 1 RP:PFM:REP 4->121|PF00903|2e-07|28.9|114/120|Glyoxalase| HM:PFM:NREP 1 HM:PFM:REP 5->122|PF00903|8e-23|26.3|118/128|Glyoxalase| RP:SCP:NREP 1 RP:SCP:REP 1->123|1sp9A|3e-17|13.0|123/362|d.32.1.3| HM:SCP:REP 1->124|1sp8A2|3e-32|31.5|124/0|d.32.1.3|1/1|Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase| OP:NHOMO 517 OP:NHOMOORG 436 OP:PATTERN ------------------------11111111------------------------------------ ---------------------------------------------------------------------------------12-----1111--11--------------------------------------------------11111111-1111111111-11111111-1111--11------------------------------------------111111----------------------1-------------------------1111---1111111111111111111111111111111111111-11-1-----------111-1111--11-----11--------------1------------12222--------22222122221-22-22122----21111111121121---1-1111111-2222222223212111--------------------------------1--111111111111111111221111111121111-12211221111111-111111111-111111111121--1-------------------2-111111---------------------------11211111--1111211112111111112122---11--------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---1---------1111-1111111111111111111111---112212----1----1---111-11111113321111133223--------------1---11---------------------------------------------------1- ----11--21---------------------------------------------------------------------------------------------------1-------------------------------------------------------------------------113254-41------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 126 STR:RPRED 100.0 SQ:SECSTR ccccccEEEEEEccHHHHHHHHHTTTccccGGGGGccEEEEEccEEEEEEHHHHHHHcTTccccccccccEEEEEcccHHHHHHHHHHHHHTTccEEEEEEEETTTEEEEEEEcTTccEEEEEEEH DISOP:02AL 1-1| PSIPRED cccEEEEEEEEcccHHHHHHHHHHHcccEEEEEEEcccccEEEEEEEccccccEEEEEccccccccccccccEEEEEEEccHHHHHHHHHHcccEEEEcccccccccEEEEEEcccccEEEEEEcc //