[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : malD
DDBJ      :malD         maltodextrin ABC transporter, permease protein MalD
Swiss-Prot:MALD_STRR6   RecName: Full=Maltodextrin transport system permease protein malD;

Homologs  Archaea  34/68 : Bacteria  560/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:280 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   72->280 2r6gG PDBj 4e-32 36.7 %
:RPS:PDB   167->196 3dhwA PDBj 4e-05 26.7 %
:RPS:SCOP  15->280 2r6gG1  f.58.1.1 * 4e-24 31.4 %
:RPS:PFM   105->219 PF00528 * BPD_transp_1 8e-06 26.5 %
:HMM:PFM   92->273 PF00528 * BPD_transp_1 1.7e-26 16.9 178/185  
:BLT:SWISS 1->280 MALD_STRR6 e-160 100.0 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55118.1 GT:GENE malD GT:PRODUCT maltodextrin ABC transporter, permease protein MalD GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1937285..1938127 GB:FROM 1937285 GB:TO 1938127 GB:DIRECTION + GB:GENE malD GB:PRODUCT maltodextrin ABC transporter, permease protein MalD GB:NOTE identified by match to protein family HMM PF00528 GB:PROTEIN_ID ACF55118.1 GB:DB_XREF GI:194356670 GB:GENE:GENE malD LENGTH 280 SQ:AASEQ MNNSIKLKRRLTQSLTYLYLIGLSIVIIYPLLITIMSAFKAGNVSAFKLDTNIDLNFDNFKGLFTETLYGTWYLNTLIIALITMAVQTSIIVLAGYAYSRYNFLARKQSLVFFLIIQMVPTMAALTAFFVMALMLNALNHNWFLIFLYVGGGIPMNAWLMKGYFDTVPMSLDESAKLDGAGHFRRFWQIVLPLVRPMVAVQALWAFMGPFGDYILSSFLLREKEYFTVAVGLQTFVNNAKNLKIAYFSAGAILIALPICILFFFLQKNFVSGLTSGGDKG GT:EXON 1|1-280:0| SW:ID MALD_STRR6 SW:DE RecName: Full=Maltodextrin transport system permease protein malD; SW:GN Name=malD; OrderedLocusNames=spr1920; SW:KW Cell membrane; Complete proteome; Membrane; Sugar transport;Transmembrane; Transport. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->280|MALD_STRR6|e-160|100.0|280/280| GO:SWS:NREP 5 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0016021|"GO:integral to membrane"|Transmembrane| GO:SWS GO:0006810|"GO:transport"|Transport| TM:NTM 6 TM:REGION 15->37| TM:REGION 75->96| TM:REGION 110->132| TM:REGION 142->164| TM:REGION 192->214| TM:REGION 244->266| BL:PDB:NREP 1 BL:PDB:REP 72->280|2r6gG|4e-32|36.7|207/284| RP:PDB:NREP 1 RP:PDB:REP 167->196|3dhwA|4e-05|26.7|30/203| RP:PFM:NREP 1 RP:PFM:REP 105->219|PF00528|8e-06|26.5|113/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 92->273|PF00528|1.7e-26|16.9|178/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 15->280|2r6gG1|4e-24|31.4|264/284|f.58.1.1| OP:NHOMO 3096 OP:NHOMOORG 599 OP:PATTERN 221-31-123233331611121--6--51-1-----------------------2342111322---- ---1k213334-1123344-423348444443244414585415L*Z2DHE5QKO12A--767BE4EOaI47666FDA1---4-------------------------1---------------------------9BB78---84221311-11221122212221333--1-----1----EE244DE-953222222331132223TGAA4822353929457786679*111111111111111-1---5411231-12133--22---1-42542325344422666777766664333344443333355---5553G4-2A1111121514D1--1445e-25233E--231--2J--1776I2-1---------1-12-CA71--435533355355455C---6--3-19K--UVVJbYPokeVQ22---9G87558C85--------1112--12-----------------------------1---2-133336776665233344894443335562223--2226-23332667C11-----2--------------1-1--111--11111---------222214----------1------------------125-------6----------------------1---------15681312222222222-22222223222212222214545511112111111111111116---2221--488888888888---------11111-86E111111-----1--1----------1-22222233422233656----------1222222223154311111111111111-------------------1A1-----1---1-1---1---31---7NFC99S9DA-1- -------------2------------------------------------------------------------------------------------------------------------------------------------------------2-----------1--------------1--------1---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 93.9 SQ:SECSTR ################cHHHHHHHHHTHHHHHHHHTTcccccccccHHHHHHHHHTccTTHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccTTcHHHHHHHHHTTccccccHHHHHHHHHHHHHcTTcHHHHHHHHTTTHTHHHHHHHHHHHTTccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTccHHHHHHcccGGGccHHHHGGGGc#ccccccHHHHHHHHHHTHHHHHHHHHHHTTTccccccTTTccc DISOP:02AL 1-4| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccc //