[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : malR
DDBJ      :malR         maltose operon transcriptional
Swiss-Prot:MALR_STRR6   RecName: Full=HTH-type transcriptional regulator malR;AltName: Full=Maltose operon transcriptional repressor;

Homologs  Archaea  0/68 : Bacteria  559/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
a.35.1c.93.1
:328 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->276 1zvvA PDBj 1e-30 32.0 %
:RPS:PDB   3->300 1efaA PDBj 4e-48 22.1 %
:RPS:SCOP  4->57 1bdhA1  a.35.1.5 * 2e-18 50.0 %
:RPS:SCOP  63->300 1rzrA2  c.93.1.1 * 2e-39 27.5 %
:HMM:SCOP  1->59 1efaA1 a.35.1.5 * 4.1e-19 54.2 %
:HMM:SCOP  61->310 1dbqA_ c.93.1.1 * 1.3e-43 34.9 %
:RPS:PFM   4->49 PF00356 * LacI 1e-10 56.5 %
:RPS:PFM   60->277 PF00532 * Peripla_BP_1 1e-23 30.7 %
:HMM:PFM   4->49 PF00356 * LacI 3.2e-24 56.5 46/46  
:HMM:PFM   61->311 PF00532 * Peripla_BP_1 3.6e-23 27.2 243/279  
:BLT:SWISS 1->328 MALR_STRR6 e-178 100.0 %
:PROS 5->23|PS00356|HTH_LACI_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55857.1 GT:GENE malR GT:PRODUCT maltose operon transcriptional GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1939190..1940176 GB:FROM 1939190 GB:TO 1940176 GB:DIRECTION + GB:GENE malR GB:PRODUCT maltose operon transcriptional GB:NOTE identified by match to protein family HMM PF00356; match to protein family HMM PF00532 GB:PROTEIN_ID ACF55857.1 GB:DB_XREF GI:194357409 GB:GENE:GENE malR LENGTH 328 SQ:AASEQ MPVTIKDVAKAAGVSPSTVTRVIQNKSTISDETKKRVRKAMKELNYHPNLNARSLVSSYTQVIGLVLPDDSDAFYQNPFFPSVLRGISQVASENHYAIQIATGKDEKERLNAISQMVYGKRVDGLIFLYAQEEDPLVKLVAEEQFPFLILGKSLSPFIPLVDNDNVQAGFDATEYFIKKGCKRIAFIGGSKKLFVTKDRLTGYEQALKHYKLTTDNNRIYFADEFLEEKGYKFSKRLFKHDPQIDAIITTDSLLAEGVCNYIAKHQLDVPVLSFDSVNPKLNLAAYVDINSLELGRVSLETILQIINDNKNNKQICYRQLIAHKIIEK GT:EXON 1|1-328:0| SW:ID MALR_STRR6 SW:DE RecName: Full=HTH-type transcriptional regulator malR;AltName: Full=Maltose operon transcriptional repressor; SW:GN Name=malR; OrderedLocusNames=spr1922; SW:KW Complete proteome; Direct protein sequencing; DNA-binding; Repressor;Transcription; Transcription regulation. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->328|MALR_STRR6|e-178|100.0|328/328| GO:SWS:NREP 3 GO:SWS GO:0003677|"GO:DNA binding"|DNA-binding| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| PROS 5->23|PS00356|HTH_LACI_1|PDOC00366| SEG 302->315|ilqiindnknnkqi| BL:PDB:NREP 1 BL:PDB:REP 1->276|1zvvA|1e-30|32.0|269/332| RP:PDB:NREP 1 RP:PDB:REP 3->300|1efaA|4e-48|22.1|290/328| RP:PFM:NREP 2 RP:PFM:REP 4->49|PF00356|1e-10|56.5|46/46|LacI| RP:PFM:REP 60->277|PF00532|1e-23|30.7|212/261|Peripla_BP_1| HM:PFM:NREP 2 HM:PFM:REP 4->49|PF00356|3.2e-24|56.5|46/46|LacI| HM:PFM:REP 61->311|PF00532|3.6e-23|27.2|243/279|Peripla_BP_1| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF00356|IPR000843| GO:PFM GO:0005622|"GO:intracellular"|PF00356|IPR000843| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00356|IPR000843| RP:SCP:NREP 2 RP:SCP:REP 4->57|1bdhA1|2e-18|50.0|54/56|a.35.1.5| RP:SCP:REP 63->300|1rzrA2|2e-39|27.5|229/272|c.93.1.1| HM:SCP:REP 1->59|1efaA1|4.1e-19|54.2|59/59|a.35.1.5|1/1|lambda repressor-like DNA-binding domains| HM:SCP:REP 61->310|1dbqA_|1.3e-43|34.9|241/282|c.93.1.1|1/1|Periplasmic binding protein-like I| OP:NHOMO 4190 OP:NHOMOORG 563 OP:PATTERN -------------------------------------------------------------------- 7661h-1366A1---11--------A-------111137D7-29GRI-DDA1OIL-14--8577L4KNQG4B999AHG3---3-----2221-2-----1-7-419-A4B--------------------------67854---A----------------------1-1-------------47-22BA-B6ABBBAB98C7BAA989EDAA9AAB857C28579BBBAA4N54444444444444432266A561762A314AA77455459A6566777886854366666566666555544555555555533255578417D2222222A293511478AG4221226--------I1-489981-2--1EBB4-----2-433--------4434344434B---3--3125C--OCDCMJMUSQKG447136B74534745--------32211--1------------------------------38251244138BCCB853333669F5454379873553--4447-51133824D----1--2----------------1----1--3------------------5-----------------------------BBF6-77-84B5454633333412233115-------------IIHF7KECCCCCDEDDB-CB9CFCBCDECCCDEADECJMJHG779EECDEEEEEEDDEDCCO99BBBAC6-IFGGFFGDFGGG---------------95A444657133333336------1---6744442548133341655----------A899BBBBBC99EE76AAAAA7871111---2----------------5------1------------------557623A544--- -------------1------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------2--------4---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 301 STR:RPRED 91.8 SQ:SECSTR HcccHHHHHHTTTccHHHHHHHHTTcccccTHHHHHHHHHHHHHTccccHHHHHHTTccccEEEEEEccTTTTcTTcHHHHHHHHHHHHHHHHTTcEEEEEcccccHHHHHHHHHHHHHTTccEEEEEccccHHHHHHHHHHccccEEEccccTTccccEEEEcHHHHHHHHHHHHHHTTcccEEEEEccTTcHHHHHHHHHHHHHHHTTTccccGGGEEEEccccHHHHHHHHHHHHHTTccccEEEEccHHHHHHHHHHHHTTTcccTTcEEEEEEGccccccEEEccHHHHHHHHHHH########################### DISOP:02AL 1-1,310-310| PSIPRED ccccHHHHHHHHcccHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHccccEEEEEEEcccccccccccHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEEEccccccccEEEEcHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHccccccEEEEccHHHHHHHHHHHHHcccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccEEEEcEEEEEc //