[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : malX
DDBJ      :malX         maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein
Swiss-Prot:MALX_STRPN   RecName: Full=Maltose/maltodextrin-binding protein;Flags: Precursor;

Homologs  Archaea  23/68 : Bacteria  315/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:423 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   60->418 2zyoA PDBj 1e-45 32.2 %
:RPS:PDB   43->409 1a7lC PDBj 5e-55 28.2 %
:RPS:SCOP  42->420 1a7lA  c.94.1.1 * 9e-38 24.4 %
:HMM:SCOP  24->418 1eljA_ c.94.1.1 * 4.3e-80 30.5 %
:RPS:PFM   50->332 PF01547 * SBP_bac_1 7e-12 34.0 %
:HMM:PFM   52->335 PF01547 * SBP_bac_1 3.6e-36 29.8 272/314  
:BLT:SWISS 1->423 MALX_STRPN 0.0 99.5 %
:PROS 144->161|PS01037|SBP_BACTERIAL_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56336.1 GT:GENE malX GT:PRODUCT maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1934609..1935880 GB:FROM 1934609 GB:TO 1935880 GB:DIRECTION + GB:GENE malX GB:PRODUCT maltose/maltodextrin ABC transporter, maltose/maltodextrin-binding protein GB:NOTE identified by match to protein family HMM PF01547 GB:PROTEIN_ID ACF56336.1 GB:DB_XREF GI:194357888 GB:GENE:GENE malX LENGTH 423 SQ:AASEQ MSSKFMKSAAVLGTATLASLLLVACGSKTADKPADSGSSEVKELTVYVDEGYKSYIEEVAKAYEKEAGVKVTLKTGDALGGLDKLSLDNQSGNVPDVMMAPYDRVXSLGSDGQLSEVKLSDGAKTDDTTKSLVTAANGKVYGAPAVIESLVMYYNKDLVKDAPKTFADLENLAKDSKYAFAGEDGKTTAFLADWTNFYYTYGLLAGNGAYVFGQNGKDAKDIGLANDGSIVGINYAXSWYEKWPKGMQDTEGAGNLIQTQFQEGKTAAIIDGPWKAQAFKDAKVNYGVATIPTLPNGKEYAAFGGGKAWVIPQAVKNLEASQKFVDFLVATEQQKVLYDKTNEIPANTEARSYAEGKNDELTTAVIKQFKNTQPLPNISQMSAVWDPAKNMLFDAVSGQKDAKTAANDAVTLIKETIKQKFGE GT:EXON 1|1-423:0| SW:ID MALX_STRPN SW:DE RecName: Full=Maltose/maltodextrin-binding protein;Flags: Precursor; SW:GN Name=malX; OrderedLocusNames=SP_2108; SW:KW Cell membrane; Complete proteome; Lipoprotein; Membrane; Palmitate;Signal; Sugar transport; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->423|MALX_STRPN|0.0|99.5|423/423| GO:SWS:NREP 4 GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 144->161|PS01037|SBP_BACTERIAL_1|PDOC00796| BL:PDB:NREP 1 BL:PDB:REP 60->418|2zyoA|1e-45|32.2|348/385| RP:PDB:NREP 1 RP:PDB:REP 43->409|1a7lC|5e-55|28.2|354/362| RP:PFM:NREP 1 RP:PFM:REP 50->332|PF01547|7e-12|34.0|259/282|SBP_bac_1| HM:PFM:NREP 1 HM:PFM:REP 52->335|PF01547|3.6e-36|29.8|272/314|SBP_bac_1| GO:PFM:NREP 2 GO:PFM GO:0005215|"GO:transporter activity"|PF01547|IPR006059| GO:PFM GO:0006810|"GO:transport"|PF01547|IPR006059| RP:SCP:NREP 1 RP:SCP:REP 42->420|1a7lA|9e-38|24.4|369/380|c.94.1.1| HM:SCP:REP 24->418|1eljA_|4.3e-80|30.5|367/380|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 493 OP:NHOMOORG 339 OP:PATTERN --1----111111-112-1111--1--1--1-----------------------11-111--1----- ----6-11--1---------------------------------2431111-314-1---11-21-133313233122----------------------------------------------------------111-----2--------------------------------------2211122-11-222221331222222222212222112-12123323329-11111111111111-----11---1--11111----------1122322222111111111111112111122221111112---22211--12-----1-1----11-2112-1---12--------3---22111-----------------1--------111111111112----------1---11-11121211------------------------------------------------------------------------------------11--------1-----------1------------------------------1-----------------------11-11------------------------------121----------------------------------------121111-1111111111-11111112111111111112221111-11111111111111111-1-1111--122222222222---------------2--111221-----1--------------1--------1----1--------------2241111111322----------------------------------1-------------------------1432224222--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 420 STR:RPRED 99.3 SQ:SECSTR #cGGGcEcccccccHHHccccEEEEEccTTEEcEEEccccTTcEEEEccTccHHHHHHHHHHHHHHHcccEEEEccTTHHHHHHHHHHGGGTccccEEEEEGGGHHHHHHTTccccccccHHHHTTTccHHHHHHTTTEEccEEEEEEccEEEEETTTccccccccTTHHHHHHHHHTTTcETTTcccccccccccHHHHHHHHHHTTcEEEEEccEEEEEEETTcHHHHHHHHHHHHHHHTcccTcccTTccHHHHHHHHHTTcccEEEEcGGGHHHHHHHTccEEEEccccccTTcccccEEEEEEEEEcTTcTTHHHHHHHHHHTTccHHHHHHHHHHccccEEccHHHHHHHTTcHHHHHHHHHHHHcEEccccTTHHHHHHHHHHHHHHHHHTcccHHHHHHHTHHHHcccccHHH## DISOP:02AL 1-6,26-41,421-424| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEEEEEcccHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHcccccccccHHccccccccHHHHccccccEEEEEEEEccEEEEEEHHHHHHccccHHHHHHHHHHHHHcccccccccEEcccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHcccEEEEEEcHHHHHHHHcccccEEEEEEcccccccccEEEEEEEEEEEEcccccHHHHHHHHHHHHcHHHHHHHHHHcccccccHHHHccHHHHccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccc //