[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : metA
DDBJ      :metA         homoserine O-succinyltransferase
Swiss-Prot:META_STRP4   RecName: Full=Homoserine O-succinyltransferase;         EC=2.3.1.46;AltName: Full=Homoserine O-transsuccinylase;         Short=HTS;

Homologs  Archaea  0/68 : Bacteria  336/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:314 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->297 2h2wA PDBj 1e-89 54.7 %
:RPS:PDB   218->268 3bduA PDBj 3e-13 20.8 %
:RPS:SCOP  18->297 2ghrA1  c.23.16.8 * 1e-72 52.2 %
:HMM:SCOP  17->297 2ghrA1 c.23.16.8 * 3.5e-94 44.5 %
:RPS:PFM   2->298 PF04204 * HTS e-105 59.3 %
:HMM:PFM   2->299 PF04204 * HTS 1.6e-135 59.1 298/298  
:BLT:SWISS 1->314 META_STRP4 0.0 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56179.1 GT:GENE metA GT:PRODUCT homoserine O-succinyltransferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1447767..1448711) GB:FROM 1447767 GB:TO 1448711 GB:DIRECTION - GB:GENE metA GB:PRODUCT homoserine O-succinyltransferase GB:NOTE identified by match to protein family HMM PF04204; match to protein family HMM TIGR01001 GB:PROTEIN_ID ACF56179.1 GB:DB_XREF GI:194357731 GB:GENE:GENE metA LENGTH 314 SQ:AASEQ MPIRIDKKLPAVEILRTENIFVMDDQRAAHQDIRPLKILILNLMPQKMVTETQLLRHLANTPLQLDIDFLYMESHRSKTTRSEHMETFYKTFLEVKDEYFDGMIITGAPVEHLPFEEVDYWEEFRQMLEWSKTHVYSTLHICWGAQAGLYLRYGVEKYQMDSKLSGIYPQDTLKEGHLLFRGFDDSYVSPHSRHTEISKEEVLNKTNLEILSEGPQVGVSILASRDLREIYSFGHLEYDRDTLAKEYFRDRDAGFDPHIPENYFKDDDVNQVPCLCWSSSAALFFSNWVNHAVYQETPFXWRKIXDDASAYGYL GT:EXON 1|1-314:0| SW:ID META_STRP4 SW:DE RecName: Full=Homoserine O-succinyltransferase; EC=2.3.1.46;AltName: Full=Homoserine O-transsuccinylase; Short=HTS; SW:GN Name=metA; OrderedLocusNames=SPG_1502; SW:KW Acyltransferase; Amino-acid biosynthesis; Complete proteome;Cytoplasm; Methionine biosynthesis; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->314|META_STRP4|0.0|100.0|314/314| GO:SWS:NREP 5 GO:SWS GO:0008415|"GO:acyltransferase activity"|Acyltransferase| GO:SWS GO:0008652|"GO:cellular amino acid biosynthetic process"|Amino-acid biosynthesis| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0009086|"GO:methionine biosynthetic process"|Methionine biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 2->297|2h2wA|1e-89|54.7|289/289| RP:PDB:NREP 1 RP:PDB:REP 218->268|3bduA|3e-13|20.8|48/51| RP:PFM:NREP 1 RP:PFM:REP 2->298|PF04204|e-105|59.3|297/297|HTS| HM:PFM:NREP 1 HM:PFM:REP 2->299|PF04204|1.6e-135|59.1|298/298|HTS| GO:PFM:NREP 3 GO:PFM GO:0005737|"GO:cytoplasm"|PF04204|IPR005697| GO:PFM GO:0008415|"GO:acyltransferase activity"|PF04204|IPR005697| GO:PFM GO:0019281|"GO:L-methionine biosynthetic process from homoserine via O-succinyl-L-homoserine and cystathionine"|PF04204|IPR005697| RP:SCP:NREP 1 RP:SCP:REP 18->297|2ghrA1|1e-72|52.2|268/269|c.23.16.8| HM:SCP:REP 17->297|2ghrA1|3.5e-94|44.5|281/0|c.23.16.8|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 342 OP:NHOMOORG 337 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------1----------------------------11111111-11------111111---------------1---------------------------------------------11111111--------111111111111-------111111111111111111111111111111111--------111--------------1-----1--1122-1-111111-1-1111-1-------11111111111111-------------111111111--1-11111111111111221---1111--11--11--------------1--------------21----1-11-11111111111-111111--1---111111111111--11-1111111111-----------------------------------------------11---------------------1--------------------------------1--------------------------1----------------------------111----1--------------1111--1-11111111111111111111111--1--1------11111111111111111-11111111111111111111111111111111111111111111111-1111-11111111111111-----------1------------------------------------------------1---------11111111111111-------11-----11----------------------------------------------1--1-111--- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 94.3 SQ:SECSTR #cEEEcccccHHHHHHHHHHccccTTcccHHHHcccccEEEccccccTTTcccccccGGGccEEEEEEccccHHHHHHHHHTTEEEETTccHHHHHTTcccEEEEEEEccTcTccGGGTTGGGHHHHHHHHHHccccEEEETHHHHHHHHHHTTcEEEEEEEEEEEEEEEEEETcccGGGTTcccEEEEEEEEEEEEEcccTTccTTEEEEEEcccccEEEEEETTccEEEEEcccEEcTTTcEEEEcTTHHTccEEEEcGGGEEEEETTcccccccHHHHHHHHHHHHHHTTTTTc################# PSIPRED ccEEccccccHHHHHHHcccEEEcHHHHcccccccEEEEEEEccccHHHHHHHHHHHHccccEEEEEEEEEccccccccccHHHHHHHcccHHHHccccccEEEEEccccccccHHHccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEEEEcccccccccccccEEcccHHHccccHHHHHHccccEEEEEcccccEEEEEEccccEEEEEccccccHHHHHHHHHHHHHcccccccccccccccccccccccEEccHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccc //