[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : metF
DDBJ      :metF         5,10-methylenetetrahydrofolate reductase
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  529/915 : Eukaryota  174/199 : Viruses  0/175   --->[See Alignment]
c.1.23
:288 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->269 1zrqC PDBj 9e-40 35.2 %
:RPS:PDB   6->277 1b5tC PDBj 1e-38 33.8 %
:RPS:SCOP  6->276 1b5tA  c.1.23.1 * 7e-66 33.8 %
:HMM:SCOP  4->283 1b5tA_ c.1.23.1 * 1.1e-73 36.7 %
:RPS:PFM   3->269 PF02219 * MTHFR 4e-51 39.2 %
:HMM:PFM   4->276 PF02219 * MTHFR 5.7e-74 35.4 271/287  
:BLT:SWISS 7->269 METF_PECCC 1e-40 34.9 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55056.1 GT:GENE metF GT:PRODUCT 5,10-methylenetetrahydrofolate reductase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 517950..518816 GB:FROM 517950 GB:TO 518816 GB:DIRECTION + GB:GENE metF GB:PRODUCT 5,10-methylenetetrahydrofolate reductase GB:NOTE identified by match to protein family HMM PF02219; match to protein family HMM TIGR00676 GB:PROTEIN_ID ACF55056.1 GB:DB_XREF GI:194356608 GB:GENE:GENE metF LENGTH 288 SQ:AASEQ MSRQTPSLSFEVFPPNPAVGNGNIISALQDMQELAPHFISVTASNNKFNIKETTVRLADFIQNDLAIPTIAHLPAIYLTKDKVAETIADLDKVGVQKILALRGDIIPDVEPQKDFRYATDLIEFIKEQTPHFDIIGACYPEGHPDSPNQISDIQNLKKKVDAGCSSLVTQLFFDNERFYDFQDKCILAGIDVPIHAGIMPILNRNQALRLLKTCENIHLPRKFKAILDKYEHDPESLRAAGLAYAVDQIVDLVTQDVAGVHLYTMNNADTAKYIHQATHALFNHQSLG GT:EXON 1|1-288:0| BL:SWS:NREP 1 BL:SWS:REP 7->269|METF_PECCC|1e-40|34.9|258/298| BL:PDB:NREP 1 BL:PDB:REP 7->269|1zrqC|9e-40|35.2|253/268| RP:PDB:NREP 1 RP:PDB:REP 6->277|1b5tC|1e-38|33.8|260/267| RP:PFM:NREP 1 RP:PFM:REP 3->269|PF02219|4e-51|39.2|265/284|MTHFR| HM:PFM:NREP 1 HM:PFM:REP 4->276|PF02219|5.7e-74|35.4|271/287|MTHFR| GO:PFM:NREP 3 GO:PFM GO:0004489|"GO:methylenetetrahydrofolate reductase (NADPH) activity"|PF02219|IPR003171| GO:PFM GO:0006555|"GO:methionine metabolic process"|PF02219|IPR003171| GO:PFM GO:0055114|"GO:oxidation reduction"|PF02219|IPR003171| RP:SCP:NREP 1 RP:SCP:REP 6->276|1b5tA|7e-66|33.8|266/275|c.1.23.1| HM:SCP:REP 4->283|1b5tA_|1.1e-73|36.7|275/0|c.1.23.1|1/1|FAD-linked oxidoreductase| OP:NHOMO 844 OP:NHOMOORG 705 OP:PATTERN ------------------------1---1--------------------------------------- ----11111111111---------------------11111111111-1----111-1--111-12211111111111---1-11111111211-----111-1111111---------------11111111111--------------------------------------------------11---------------------------------------------------------------------111--1-----11----1-111-------1--11111111111-------------111111111--11--1111111111--------1-1----1----11-2-1--111-1-1--11111-----111111111111111111111111-11111111111-111111111111111111111111111--------11111-11------------------------------1111111111111111111111111111111111111111111111111111111111111111111111111111-1111111112111-1-11---1111111--------11111---------------111-1111--1--111111111111111-1111-1111111111111111111111111111-1111111111111111111111111111111111111111111111111111-11111111111111-111111----1111-111-11-1111111111111111111111111111111111111---------1111111111111111111111111111111--111111------------------------------------1-111-1----11 ----111-21--1112222222222222222222222222222222222222222222222222222222211222222222222222-22222222222222333-2-12121112111111121-21491-212-11111121-11--11111-2-11121211-111-2231111-----1121122422222221 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 276 STR:RPRED 95.8 SQ:SECSTR #TccccEEEEEEcccccHHHHHHHHHHHHHHHTTcccEEEEcccccHHHHcHHHHHHHHHHHHHTcccEEEEEEcTTccHHHHHHHHHHHHHTTccEEEEEcccccTTTHHHHHHccHHHHHHHHHcHHcccEEEEEEcTTccTTcccHHHHHHHHHHHHHHTEEEEEEcccccHHHHHHHHHHHHHTTccccEEcEEcccccHHHHHHHHHHHHTccccHHHHHHHTTcTTcHHHHHHHHHHHHHHHHHHHHHTTccEEEEEcTTccHHHHHHHHH########### DISOP:02AL 1-3,287-289| PSIPRED ccccccEEEEEEcccccHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHHHHHccccEEHHHccccHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHcccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHcccccccccc //