[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : metK
DDBJ      :metK         S-adenosylmethionine synthetase, central domain
Swiss-Prot:METK_STRR6   RecName: Full=S-adenosylmethionine synthetase;         EC=2.5.1.6;AltName: Full=Methionine adenosyltransferase;AltName: Full=AdoMet synthetase;AltName: Full=MAT;

Homologs  Archaea  2/68 : Bacteria  875/915 : Eukaryota  192/199 : Viruses  0/175   --->[See Alignment]
d.130.1
:396 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->394 1p7lA PDBj e-133 61.6 %
:RPS:PDB   65->314 1dxjA PDBj 4e-56 12.8 %
:RPS:SCOP  4->104 1fugA1  d.130.1.1 * 3e-41 61.4 %
:RPS:SCOP  119->244 1fugA2  d.130.1.1 * 4e-51 52.8 %
:RPS:SCOP  245->396 1fugA3  d.130.1.1 * 2e-73 66.0 %
:HMM:SCOP  3->104 1mxaA1 d.130.1.1 * 3.2e-42 65.7 %
:HMM:SCOP  120->244 1mxaA2 d.130.1.1 * 6.3e-50 64.5 %
:HMM:SCOP  245->390 1qm4A3 d.130.1.1 * 8.1e-75 71.6 %
:RPS:PFM   6->102 PF00438 * S-AdoMet_synt_N 8e-31 66.0 %
:RPS:PFM   126->243 PF02772 * S-AdoMet_synt_M 2e-46 66.1 %
:RPS:PFM   245->384 PF02773 * S-AdoMet_synt_C 1e-61 74.6 %
:HMM:PFM   245->384 PF02773 * S-AdoMet_synt_C 8.3e-71 67.4 138/138  
:HMM:PFM   126->243 PF02772 * S-AdoMet_synt_M 8.1e-57 68.6 118/120  
:HMM:PFM   4->102 PF00438 * S-AdoMet_synt_N 1.6e-42 66.7 99/100  
:BLT:SWISS 1->396 METK_STRR6 0.0 100.0 %
:PROS 127->137|PS00376|ADOMET_SYNTHETASE_1
:PROS 271->279|PS00377|ADOMET_SYNTHETASE_2

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55331.1 GT:GENE metK GT:PRODUCT S-adenosylmethionine synthetase, central domain GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 676294..677484 GB:FROM 676294 GB:TO 677484 GB:DIRECTION + GB:GENE metK GB:PRODUCT S-adenosylmethionine synthetase, central domain GB:NOTE identified by match to protein family HMM PF00438; match to protein family HMM PF02772; match to protein family HMM PF02773; match to protein family HMM TIGR01034 GB:PROTEIN_ID ACF55331.1 GB:DB_XREF GI:194356883 GB:GENE:GENE metK LENGTH 396 SQ:AASEQ MSERKLFTSESVSEGHPDKIADQISDAILDAILAKDPEAHVAAETAVYTGSVHVFGEISTNAYVDINRVVRDTIAEIGYTNTEYGFSAETVGVHPSLVEQSPDIAQGVNEALEVRGNADQDPLDLIGAGDQGLMFGFAVDETEELMPLPIALSHKLVRRLAELRKSGEISYLRPDAKSQVTVEYDENDRPVRVDTVVISTQHDPEATNEQIHQDVIDKVIKEVIPSSYLDDKTKFFINPTGRFVIGGPQGDSGLTGRKIIVDTYGGYSRHGGGAFSGKDATKVDRSASYAARYIAKNIVAAGLAKKAEVQLAYAIGVAQPVSVRIDTFGTGTVAESQLEKAARQIFDLRPAGIIQMLDLKRPIYRQTSAYGHMGRTDIDLPWERLDKVDALKEAVK GT:EXON 1|1-396:0| SW:ID METK_STRR6 SW:DE RecName: Full=S-adenosylmethionine synthetase; EC=2.5.1.6;AltName: Full=Methionine adenosyltransferase;AltName: Full=AdoMet synthetase;AltName: Full=MAT; SW:GN Name=metK; OrderedLocusNames=spr0671; SW:KW ATP-binding; Cobalt; Complete proteome; Cytoplasm; Magnesium;Metal-binding; Nucleotide-binding; One-carbon metabolism; Potassium;Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->396|METK_STRR6|0.0|100.0|396/396| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006730|"GO:one-carbon metabolic process"|One-carbon metabolism| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 127->137|PS00376|ADOMET_SYNTHETASE_1|PDOC00369| PROS 271->279|PS00377|ADOMET_SYNTHETASE_2|PDOC00369| BL:PDB:NREP 1 BL:PDB:REP 4->394|1p7lA|e-133|61.6|378/383| RP:PDB:NREP 1 RP:PDB:REP 65->314|1dxjA|4e-56|12.8|226/242| RP:PFM:NREP 3 RP:PFM:REP 6->102|PF00438|8e-31|66.0|97/100|S-AdoMet_synt_N| RP:PFM:REP 126->243|PF02772|2e-46|66.1|118/120|S-AdoMet_synt_M| RP:PFM:REP 245->384|PF02773|1e-61|74.6|138/138|S-AdoMet_synt_C| HM:PFM:NREP 3 HM:PFM:REP 245->384|PF02773|8.3e-71|67.4|138/138|S-AdoMet_synt_C| HM:PFM:REP 126->243|PF02772|8.1e-57|68.6|118/120|S-AdoMet_synt_M| HM:PFM:REP 4->102|PF00438|1.6e-42|66.7|99/100|S-AdoMet_synt_N| GO:PFM:NREP 9 GO:PFM GO:0004478|"GO:methionine adenosyltransferase activity"|PF00438|IPR002133| GO:PFM GO:0005524|"GO:ATP binding"|PF00438|IPR002133| GO:PFM GO:0006730|"GO:one-carbon metabolic process"|PF00438|IPR002133| GO:PFM GO:0004478|"GO:methionine adenosyltransferase activity"|PF02772|IPR002133| GO:PFM GO:0005524|"GO:ATP binding"|PF02772|IPR002133| GO:PFM GO:0006730|"GO:one-carbon metabolic process"|PF02772|IPR002133| GO:PFM GO:0004478|"GO:methionine adenosyltransferase activity"|PF02773|IPR002133| GO:PFM GO:0005524|"GO:ATP binding"|PF02773|IPR002133| GO:PFM GO:0006730|"GO:one-carbon metabolic process"|PF02773|IPR002133| RP:SCP:NREP 3 RP:SCP:REP 4->104|1fugA1|3e-41|61.4|101/102|d.130.1.1| RP:SCP:REP 119->244|1fugA2|4e-51|52.8|125/129|d.130.1.1| RP:SCP:REP 245->396|1fugA3|2e-73|66.0|150/152|d.130.1.1| HM:SCP:REP 3->104|1mxaA1|3.2e-42|65.7|102/102|d.130.1.1|1/1|S-adenosylmethionine synthetase| HM:SCP:REP 120->244|1mxaA2|6.3e-50|64.5|124/124|d.130.1.1|1/1|S-adenosylmethionine synthetase| HM:SCP:REP 245->390|1qm4A3|8.1e-75|71.6|141/144|d.130.1.1|1/1|S-adenosylmethionine synthetase| OP:NHOMO 1351 OP:NHOMOORG 1069 OP:PATTERN ------------------------------------------------------------------11 1221111111211111111-1111111111111111111112211111111111111111111222211111111111111111111111111111---11111111111--------------1111111111112112211211111122111111111111111221111111111111111111--1111111111211111111111111111111111111111111111111111111111111111111111111111111111111111112111111121111111111111112111111111111111111121121111111121213311111111111111112111121121111111111111111111-1111111211111111111111-11111111121111111111111111111111111111111111111111111121121111111---1----2---211111111111111111111111111111111111111111111111111111111111111111111111111111112111131111111111111221111111111111111111111111111111111121122111111111111111111111111111111111-111221--11111111111112111211-111111211112111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112---11-11111111111111111111111111111111 1111111-429111111111111212111111111111111111111-1111111111111111111111221111222211111111-11111111111111112-12337C55581242222322328I2-32412123212122221213322322-3911232A21368411111N211115358154-231116 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 394 STR:RPRED 99.5 SQ:SECSTR ccccEEEEEEEEEEccEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHTccHHHHcGGGEEcGGGTcHHHHHHHTTTTTcTTccccccccHHHHHHHHTTcTHHHHHTTTTcccHHHHHEEEHHcHHHHHHHHHHHHHTccccTTGGGcTTccccccccccccccTTccccTTccTcccHHHHHHHHHHHHHHTccTTTcTTHHHHcHHHHHHHHHHcccTTcccHHHHHTTcccccHHHHHTTccccHHHHHHHHTTTTTTTcccHHHHHccccccHHHHHHHHHHHHHHHHHTcccccccccTTcccccTTcccccEEEEEcTTcccccHHHHHHHHHHHccccHHHHHHHHTccccccGGGGcccccccTcTTcTTTcccHHHHHHHT## DISOP:02AL 1-2| PSIPRED cccccEEEcccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEEccEEEEEEEEEcccEEcHHHHHHHHHHHcccccccccccccEEEEEEcccccccccccccccccccccccccccHHHccccccEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEEcccEEEEEEEEEEEEEccccccHHHHHHHHHHHHHHHHccccccccccEEEEcccccEEcccccccccccccEEEEEccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEcccccccEEEEEEcccccccHHHHHHHHHHHccccHHHHHHHccccccccccccccccccccccccccccHHHHHHHHHHHc //