[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : mscL
DDBJ      :mscL         large conductance mechanosensitive channel protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  385/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.16.1
:125 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->87 2oarA PDBj 1e-14 47.6 %
:RPS:SCOP  11->95 2oarA1  f.16.1.1 * 5e-21 37.6 %
:HMM:SCOP  10->119 2oarA1 f.16.1.1 * 7.5e-25 50.0 %
:RPS:PFM   1->95 PF01741 * MscL 1e-14 51.6 %
:HMM:PFM   1->124 PF01741 * MscL 6.1e-32 41.8 122/128  
:BLT:SWISS 1->95 MSCL_BDEBA 6e-18 48.9 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55547.1 GT:GENE mscL GT:PRODUCT large conductance mechanosensitive channel protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(902983..903360) GB:FROM 902983 GB:TO 903360 GB:DIRECTION - GB:GENE mscL GB:PRODUCT large conductance mechanosensitive channel protein GB:NOTE identified by match to protein family HMM PF01741; match to protein family HMM TIGR00220 GB:PROTEIN_ID ACF55547.1 GB:DB_XREF GI:194357099 GB:GENE:GENE mscL LENGTH 125 SQ:AASEQ MLKNLKSFLLRGNVIDLAVGVVIASAFGAIVTSLVNDIITPLILNPALKAAKVERIAQLSWHGVGYGNFLSAIINFIFVGTALFFIIKGIEKAQKLTGIKEEKTDEKKPTELEVLQEIKALLEKK GT:EXON 1|1-125:0| BL:SWS:NREP 1 BL:SWS:REP 1->95|MSCL_BDEBA|6e-18|48.9|90/144| TM:NTM 2 TM:REGION 18->40| TM:REGION 65->87| SEG 100->113|keektdekkptele| BL:PDB:NREP 1 BL:PDB:REP 1->87|2oarA|1e-14|47.6|84/125| RP:PFM:NREP 1 RP:PFM:REP 1->95|PF01741|1e-14|51.6|95/127|MscL| HM:PFM:NREP 1 HM:PFM:REP 1->124|PF01741|6.1e-32|41.8|122/128|MscL| GO:PFM:NREP 3 GO:PFM GO:0005216|"GO:ion channel activity"|PF01741|IPR001185| GO:PFM GO:0006810|"GO:transport"|PF01741|IPR001185| GO:PFM GO:0016021|"GO:integral to membrane"|PF01741|IPR001185| RP:SCP:NREP 1 RP:SCP:REP 11->95|2oarA1|5e-21|37.6|85/109|f.16.1.1| HM:SCP:REP 10->119|2oarA1|7.5e-25|50.0|106/0|f.16.1.1|1/1|Gated mechanosensitive channel| OP:NHOMO 394 OP:NHOMOORG 389 OP:PATTERN -------------------------------------------------------------------- -1---111111-1-1--11-1-1111111111-1111-----11-11-----11111111----1-----------11-111---------1-111---111--1111-1---------------1-----1----11111--------1-----11---11-1--1----------------1-111----1-11111111-111111--1111111111---1------1111111111-11111-1---111111111111111111-1111-1111111111111111111111111111111111111111---1111--1-11111-111-11---11111--1-11---11--------11--1111---11111--111--------------------------------41--111--1-----1111-1111---1--11111111---11---------------------------------1---11111-111111--------1------11-111111111--1111--21---1--1111------------11--------------1111-1---------1--11-1----------------------111-----------------111-1--1----------------------1111111111-1111111111111111111-------------------------11----1--111111111111--1---------------1-1--1111-1--------------1-11111-11-1111------------------11111-----11111111111111--------------------11-1----1----------1------------------1 --------------2----------------------------------------------------------------------------------------------------------------------------------------------------1------1-------------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 69.6 SQ:SECSTR cHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEccccTTcccTccccEHHHHHHHHHHHHHHHHHHT###################################### DISOP:02AL 93-109,125-126| PSIPRED cHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcc //