[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : msmR
DDBJ      :msmR         msm operon regulatory protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  407/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.24.16a.4.1b.82.4
:286 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   178->272 2k9sA PDBj 3e-07 27.4 %
:RPS:PDB   9->149 2arcB PDBj 1e-07 17.7 %
:RPS:PDB   172->277 1bl0A PDBj 4e-22 19.8 %
:RPS:SCOP  24->149 1xjaA  b.82.4.1 * 1e-16 19.0 %
:RPS:SCOP  168->273 1v4aA1  a.24.16.4 * 2e-20 14.2 %
:HMM:SCOP  11->156 2arcA_ b.82.4.1 * 2e-27 29.2 %
:HMM:SCOP  171->222 1d5yA1 a.4.1.8 * 4.6e-07 25.0 %
:HMM:SCOP  225->286 1bl0A2 a.4.1.8 * 2.5e-14 38.7 %
:RPS:PFM   26->88 PF02311 * AraC_binding 6e-09 38.1 %
:RPS:PFM   234->272 PF00165 * HTH_AraC 1e-04 48.7 %
:HMM:PFM   17->152 PF02311 * AraC_binding 7.2e-32 30.8 133/136  
:HMM:PFM   182->222 PF00165 * HTH_AraC 1.1e-10 26.8 41/42  
:HMM:PFM   235->272 PF00165 * HTH_AraC 8.9e-11 48.6 37/42  
:BLT:SWISS 3->274 MSMR_STRMU 3e-55 41.7 %
:PROS 226->268|PS00041|HTH_ARAC_FAMILY_1

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55958.1 GT:GENE msmR GT:PRODUCT msm operon regulatory protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1723409..1724269 GB:FROM 1723409 GB:TO 1724269 GB:DIRECTION + GB:GENE msmR GB:PRODUCT msm operon regulatory protein GB:NOTE identified by match to protein family HMM PF00165; match to protein family HMM PF02311 GB:PROTEIN_ID ACF55958.1 GB:DB_XREF GI:194357510 GB:GENE:GENE msmR LENGTH 286 SQ:AASEQ MLVFSEYQTGTIDLALSFYGYEECTPNYSFGPAIRDTYVLHYITKGQGKFHYKGKIVNLKEGDFFLLKPEELTFYQADSKEPWAYYWLGITGGKSPDYFALSQISDQSYLIQSETCHTQTTAKLISDIVRFAQITKSSELAQLHIMGQLHELMFHLGTIAPNQKKKNISSTHQLYLECKRLIDSHYPQSLTIQDLAKELSVHRSYLSSVFKEFNTLSPKEYLLYVRMHRARQLLENTQESIKVIAYSVGFSDPLHFSKAYKQYFNQTPSHTRKEYSQYQLVRKATL GT:EXON 1|1-286:0| BL:SWS:NREP 1 BL:SWS:REP 3->274|MSMR_STRMU|3e-55|41.7|266/278| PROS 226->268|PS00041|HTH_ARAC_FAMILY_1|PDOC00040| BL:PDB:NREP 1 BL:PDB:REP 178->272|2k9sA|3e-07|27.4|95/107| RP:PDB:NREP 2 RP:PDB:REP 9->149|2arcB|1e-07|17.7|141/164| RP:PDB:REP 172->277|1bl0A|4e-22|19.8|106/116| RP:PFM:NREP 2 RP:PFM:REP 26->88|PF02311|6e-09|38.1|63/130|AraC_binding| RP:PFM:REP 234->272|PF00165|1e-04|48.7|39/40|HTH_AraC| HM:PFM:NREP 3 HM:PFM:REP 17->152|PF02311|7.2e-32|30.8|133/136|AraC_binding| HM:PFM:REP 182->222|PF00165|1.1e-10|26.8|41/42|HTH_AraC| HM:PFM:REP 235->272|PF00165|8.9e-11|48.6|37/42|HTH_AraC| GO:PFM:NREP 5 GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF02311|IPR003313| GO:PFM GO:0003700|"GO:transcription factor activity"|PF00165|IPR000005| GO:PFM GO:0005622|"GO:intracellular"|PF00165|IPR000005| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF00165|IPR000005| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF00165|IPR000005| RP:SCP:NREP 2 RP:SCP:REP 24->149|1xjaA|1e-16|19.0|126/165|b.82.4.1| RP:SCP:REP 168->273|1v4aA1|2e-20|14.2|106/151|a.24.16.4| HM:SCP:REP 11->156|2arcA_|2e-27|29.2|144/0|b.82.4.1|1/1|Regulatory protein AraC| HM:SCP:REP 171->222|1d5yA1|4.6e-07|25.0|52/54|a.4.1.8|1/2|Homeodomain-like| HM:SCP:REP 225->286|1bl0A2|2.5e-14|38.7|62/0|a.4.1.8|1/1|Homeodomain-like| OP:NHOMO 1127 OP:NHOMOORG 409 OP:PATTERN -------------------------------------------------------------------- -----1-------------------1-------------1-------------------------------1------1---------1184-2-----11711-F16-5---------------------------11-------51----1----------1---42-------------------11--22111113-31121231BA332311122391113332327*-222222222222221--12331----1-2211--2--131411-1121321212211111111111122211211222232311-2221863-84443333233A1221333D1221-25--63----21-11-2E--2--2---------1-32----1---2------------11-11111-1--2113-13421142----3312111311------------------------------------------------2-------56666443331333433331374311------31--------11--------------------1--1--1---113----------1----------1---------------------1-2--116-1-3-51--1111---11-231-22-3-------------31411313443333334-4534444443434553553486-1---534435455643634514123333--2222222-2222---------------6-411-123-1111---12222314-113-678632575444A2322----------1111-----25521--1---------------11------------1-------------------------------------1-- -------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------3------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 277 STR:RPRED 96.9 SQ:SECSTR TcEEEcccccccEEEEEEEETTcTTcccEEETTccccEEEEEEEEEcEEEEETTEEEEEcTTcEEEEcTTccEEEEEcTTccEEEEEEEEEcccGGGGGGGcccEEETTEEEEcTTTHHHHHHHHHHHHHHHHHHHTTcTTccEEEEEEccHHHHHTTcGGGccTTccTTcHHHHHHHHHHHHTTTTcccccHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccHHHHHHHTTcccHHHHHHHHHHHHcccHHHHHTcccc######### DISOP:02AL 159-173,273-287| PSIPRED cEEEHHcccccEEEccccccEEccccccccccccccEEEEEEEEccEEEEEEccEEEEEccccEEEEccccEEEEEEcccccEEEEEEEEcHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHHcccHHHHHHHHHHccccccccc //