[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : mvaK2
DDBJ      :mvaK2        phosphomevalonate kinase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  91/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.14.1d.58.26
:335 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->329 3gonA PDBj e-167 97.6 %
:RPS:PDB   1->322 2cz9A PDBj 1e-18 15.7 %
:RPS:SCOP  2->194 1k47A1  d.14.1.5 * 8e-65 81.0 %
:RPS:SCOP  195->329 1k47A2  d.58.26.4 * 9e-56 98.5 %
:HMM:SCOP  1->194 1k47A1 d.14.1.5 * 2.2e-50 37.1 %
:HMM:SCOP  195->329 1k47A2 d.58.26.4 * 4.8e-33 34.1 %
:HMM:PFM   100->154 PF00288 * GHMP_kinases_N 5e-11 41.5 53/68  
:HMM:PFM   266->320 PF08544 * GHMP_kinases_C 4.8e-07 36.4 55/82  
:HMM:PFM   211->268 PF04683 * Proteasom_Rpn13 0.00055 28.1 57/271  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56576.1 GT:GENE mvaK2 GT:PRODUCT phosphomevalonate kinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 343067..344074 GB:FROM 343067 GB:TO 344074 GB:DIRECTION + GB:GENE mvaK2 GB:PRODUCT phosphomevalonate kinase GB:NOTE identified by match to protein family HMM PF00288; match to protein family HMM PF08544; match to protein family HMM TIGR01220 GB:PROTEIN_ID ACF56576.1 GB:DB_XREF GI:194358128 GB:GENE:GENE mvaK2 LENGTH 335 SQ:AASEQ MIAVKTCGKLYWAGEYAILEPGQLALIKDIPIYMRAEIAFSDSYRIYSDMFDFAVDLRPNPDYSLIQETIALMGDFLAVRGQNLRPFSLEICGKMEREGKKFGLGSSGSVVVLVVKALLALYNLSIDQNLLFKLTSAVLLKRGDNGSMGDLACIVAEDLVLYQSFARQKVAAWLKEEKLATVLERDWGFSISQVRPTLECDFLVGWTKEVAVSSHMVQQIKQNINQNFLTSSKETVVSLVEALEQGKSEKIIEQVEVASKLLEGLSTDIYTPLLRQLKEASQDLQAVAKSSGAGGGDCGIALSFDAQSTKTLKNRWADLGIELLYQERIGHDDKS GT:EXON 1|1-335:0| TM:NTM 1 TM:REGION 105->127| SEG 99->121|gkkfglgssgsvvvlvvkallal| BL:PDB:NREP 1 BL:PDB:REP 1->329|3gonA|e-167|97.6|329/329| RP:PDB:NREP 1 RP:PDB:REP 1->322|2cz9A|1e-18|15.7|312/346| HM:PFM:NREP 3 HM:PFM:REP 100->154|PF00288|5e-11|41.5|53/68|GHMP_kinases_N| HM:PFM:REP 266->320|PF08544|4.8e-07|36.4|55/82|GHMP_kinases_C| HM:PFM:REP 211->268|PF04683|0.00055|28.1|57/271|Proteasom_Rpn13| RP:SCP:NREP 2 RP:SCP:REP 2->194|1k47A1|8e-65|81.0|184/185|d.14.1.5| RP:SCP:REP 195->329|1k47A2|9e-56|98.5|135/135|d.58.26.4| HM:SCP:REP 1->194|1k47A1|2.2e-50|37.1|194/194|d.14.1.5|1/1|Ribosomal protein S5 domain 2-like| HM:SCP:REP 195->329|1k47A2|4.8e-33|34.1|135/0|d.58.26.4|1/1|GHMP Kinase, C-terminal domain| OP:NHOMO 92 OP:NHOMOORG 92 OP:PATTERN -------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111111---11111111111111111-111111111111111111111-11---11111111111111111111111111111111111111111111-------------------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 329 STR:RPRED 98.2 SQ:SECSTR cEEEEEEEEEEEEcTTcGGGGTcEEEEEEEEEEEEEEEEEEccEEEEETTTTEEEEEccccTHHHHHHHHHHHHHHHHHTTccccEEEEEEEccccTTcTTccccHHHHHHHHHHHHHHHHTTccccHHHHHHHHHHHHHHTccccccHHHHHHHHccTTEEEEEETTTcEEEEEccTTEEEEEEEcccccHHHHHHHHHHHHHHHHHTcccGGGccGGGGGGccHHHHHHHHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHTHTccccHHHHHHHHHHHHTTccEEEcccccccEEEEEEEEGGGHHHHHHHHHHHHHHHHcTTEc###### DISOP:02AL 328-328,330-336| PSIPRED cEEEEEEEEEEEEcccEEEccccEEEEEEEccEEEEEEEEcccEEEEEccccccccccccccHHHHHHHHHHHHHHHHHcccccccEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccEEEEEEccEEEEEcccHHHHHHHHccccccccccccccccEEEEccccccEEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccEEEccccccccEEEEEEccHHHHHHHHHHHHHccccEEEEEEccccccc //