[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : nadD
DDBJ      :nadD         Nicotinate (Nicotinamide) nucleotide adenylyltransferase
Swiss-Prot:NADD_STRR6   RecName: Full=Probable nicotinate-nucleotide adenylyltransferase;         EC=2.7.7.18;AltName: Full=Deamido-NAD(+) pyrophosphorylase;AltName: Full=Deamido-NAD(+) diphosphorylase;AltName: Full=Nicotinate mononucleotide adenylyltransferase;         Short=NaMN adenylyltransferase;

Homologs  Archaea  0/68 : Bacteria  690/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
c.26.1
:209 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   24->209 1kaqA PDBj 2e-52 43.5 %
:RPS:PDB   24->209 3dv2B PDBj 1e-32 46.8 %
:RPS:SCOP  24->209 1k4kA  c.26.1.3 * 5e-46 34.6 %
:HMM:SCOP  21->211 1nupA_ c.26.1.3 * 6.5e-57 37.2 %
:RPS:PFM   28->183 PF01467 * CTP_transf_2 1e-08 33.6 %
:HMM:PFM   28->183 PF01467 * CTP_transf_2 4.3e-45 37.5 144/157  
:HMM:PFM   194->209 PF10362 * DUF2432 0.00068 62.5 16/20  
:BLT:SWISS 1->209 NADD_STRR6 e-120 98.1 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56246.1 GT:GENE nadD GT:PRODUCT Nicotinate (Nicotinamide) nucleotide adenylyltransferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1600121..1600750) GB:FROM 1600121 GB:TO 1600750 GB:DIRECTION - GB:GENE nadD GB:PRODUCT Nicotinate (Nicotinamide) nucleotide adenylyltransferase GB:NOTE identified by match to protein family HMM PF01467; match to protein family HMM TIGR00125; match to protein family HMM TIGR00482 GB:PROTEIN_ID ACF56246.1 GB:DB_XREF GI:194357798 GB:GENE:GENE nadD LENGTH 209 SQ:AASEQ MTIELLTPFTKVELEPEIKEKKRKQVGILGGNFNPVHNAHLIVADQVRQQLGLDQVLLMPEYQPPHVDKKETIPEHHRLKMLELAIEGIDGLVIETIELERKGISYTYDTMKILTEQHPDTDYYFIIGADMVDYLPKWYRIDELVDMVQFVGVQRPRYKAGTSYPVIWVDVPLMDISSSMVRDFIAQGRKPNFLLPQPVLDYIEKEGLY GT:EXON 1|1-209:0| SW:ID NADD_STRR6 SW:DE RecName: Full=Probable nicotinate-nucleotide adenylyltransferase; EC=2.7.7.18;AltName: Full=Deamido-NAD(+) pyrophosphorylase;AltName: Full=Deamido-NAD(+) diphosphorylase;AltName: Full=Nicotinate mononucleotide adenylyltransferase; Short=NaMN adenylyltransferase; SW:GN Name=nadD; OrderedLocusNames=spr1592; SW:KW ATP-binding; Complete proteome; NAD; Nucleotide-binding;Nucleotidyltransferase; Pyridine nucleotide biosynthesis; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->209|NADD_STRR6|e-120|98.1|209/209| GO:SWS:NREP 5 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016779|"GO:nucleotidyltransferase activity"|Nucleotidyltransferase| GO:SWS GO:0019363|"GO:pyridine nucleotide biosynthetic process"|Pyridine nucleotide biosynthesis| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| BL:PDB:NREP 1 BL:PDB:REP 24->209|1kaqA|2e-52|43.5|186/186| RP:PDB:NREP 1 RP:PDB:REP 24->209|3dv2B|1e-32|46.8|186/188| RP:PFM:NREP 1 RP:PFM:REP 28->183|PF01467|1e-08|33.6|134/145|CTP_transf_2| HM:PFM:NREP 2 HM:PFM:REP 28->183|PF01467|4.3e-45|37.5|144/157|CTP_transf_2| HM:PFM:REP 194->209|PF10362|0.00068|62.5|16/20|DUF2432| GO:PFM:NREP 2 GO:PFM GO:0009058|"GO:biosynthetic process"|PF01467|IPR004820| GO:PFM GO:0016779|"GO:nucleotidyltransferase activity"|PF01467|IPR004820| RP:SCP:NREP 1 RP:SCP:REP 24->209|1k4kA|5e-46|34.6|185/213|c.26.1.3| HM:SCP:REP 21->211|1nupA_|6.5e-57|37.2|191/0|c.26.1.3|1/1|Nucleotidylyl transferase| OP:NHOMO 703 OP:NHOMOORG 694 OP:PATTERN -------------------------------------------------------------------- -111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111---11111111111---------------1-1111111111111111111-11----11-----------1111----------------1111-1111111111111111111111111111112111111111221111111111111111111111111111111111111111111222111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111-1111111111-1-------------11-11111-11---------111-111111111111---------------11111111-111-11-11---------------------------1-----1111111111-11111--111111111--1111-1111-1-----111-111111111111111111111111111111111111111111111111111111111--1111-11-11-1111--1111111-1111111111111111111111111111--11111--11111111111111111111-1121111111111111111111111111111111111111111111111111-111111111111--11111111111-1111----------------------1-11111111111111111111---------1--------------111-----------111111111111111111111----1-111111111111-111111-111111111111 -1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 197 STR:RPRED 94.3 SQ:SECSTR ############HHHHHHHHHHTcEEEEEEEccccccHHHHHHHHHHHHHTTccEEEEEEcccccccccTTcccHHHHHHHHHHHHTTcTTEEEccHHHHccccccHHHHHHHHHHHcTTcEEEEEEETTTTccGGGcTTHHHHHHHcccEEEEcTTcccccccccEEEEcccccccHHHHHHHHHTTcccTTcccHHHHHHHHHTTcc DISOP:02AL 1-1,13-25| PSIPRED cccccccccccEEcccccccccccEEEEEccccccccHHHHHHHHHHHHHHcccEEEEEEccccccccccccccHHHHHHHHHHHHcccccEEEEEEEEcccccEEEHHHHHHHHHHccccEEEEEEcHHHHcccHHHHHHHHHHHHccEEEEEcccccccccccEEEEEccHHHccHHHHHHHHHccccHHHcccHHHHHHHHHcccc //