[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : nadE
DDBJ      :nadE         NAD+ synthetase
Swiss-Prot:NADE_STRP4   RecName: Full=NH(3)-dependent NAD(+) synthetase;         EC=6.3.1.5;

Homologs  Archaea  64/68 : Bacteria  427/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
c.26.2
:274 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->274 1wxiA PDBj 1e-93 66.2 %
:RPS:PDB   30->273 1bsuA PDBj 2e-46 14.5 %
:RPS:SCOP  2->274 1ee1A  c.26.2.1 * 1e-96 57.8 %
:HMM:SCOP  2->275 1wxiA1 c.26.2.1 * 1.2e-83 39.8 %
:RPS:PFM   30->235 PF02540 * NAD_synthase 1e-28 44.2 %
:HMM:PFM   23->265 PF02540 * NAD_synthase 8.2e-69 38.1 226/242  
:BLT:SWISS 1->274 NADE_STRP4 e-157 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56514.1 GT:GENE nadE GT:PRODUCT NAD+ synthetase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1323341..1324165) GB:FROM 1323341 GB:TO 1324165 GB:DIRECTION - GB:GENE nadE GB:PRODUCT NAD+ synthetase GB:NOTE identified by match to protein family HMM PF02540; match to protein family HMM TIGR00552 GB:PROTEIN_ID ACF56514.1 GB:DB_XREF GI:194358066 GB:GENE:GENE nadE LENGTH 274 SQ:AASEQ MSLQETIIQELGVKPVIDAQEEIRRSIDFLKRYLKKHPFLKTFVLGISGGQDSTLAGRLAQLAMEELRAETGDDSYKFIAVRLPYGVQADEADAQKALAFIQPDVSLVVNIKESADAMTAAVEATGSPVSDFNKGNIKARCRMIAQYALAGFHSGAVIGTDHAAENITGFFTKFGDGGADILPLYRLNKRQGKQLLQKLGAEPALYEKIPTADLEEDKPGLADEVALGVTYAEIDDYLEGKTISPEAQATIENWWHKGQHKRHLPITVFDDFWE GT:EXON 1|1-274:0| SW:ID NADE_STRP4 SW:DE RecName: Full=NH(3)-dependent NAD(+) synthetase; EC=6.3.1.5; SW:GN Name=nadE; OrderedLocusNames=SPG_1360; SW:KW ATP-binding; Complete proteome; Ligase; NAD; Nucleotide-binding. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->274|NADE_STRP4|e-157|100.0|274/274| GO:SWS:NREP 3 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0016874|"GO:ligase activity"|Ligase| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| BL:PDB:NREP 1 BL:PDB:REP 2->274|1wxiA|1e-93|66.2|260/261| RP:PDB:NREP 1 RP:PDB:REP 30->273|1bsuA|2e-46|14.5|221/236| RP:PFM:NREP 1 RP:PFM:REP 30->235|PF02540|1e-28|44.2|190/208|NAD_synthase| HM:PFM:NREP 1 HM:PFM:REP 23->265|PF02540|8.2e-69|38.1|226/242|NAD_synthase| GO:PFM:NREP 3 GO:PFM GO:0003952|"GO:NAD+ synthase (glutamine-hydrolyzing) activity"|PF02540|IPR003694| GO:PFM GO:0005524|"GO:ATP binding"|PF02540|IPR003694| GO:PFM GO:0009435|"GO:NAD biosynthetic process"|PF02540|IPR003694| RP:SCP:NREP 1 RP:SCP:REP 2->274|1ee1A|1e-96|57.8|270/271|c.26.2.1| HM:SCP:REP 2->275|1wxiA1|1.2e-83|39.8|274/0|c.26.2.1|1/1|Adenine nucleotide alpha hydrolases-like| OP:NHOMO 508 OP:NHOMOORG 494 OP:PATTERN 11111111111111112112121111111112111111111111-1-1-1111111111111111-11 -----1111111111---------------------1111-------1-11111111111--------1----------111-----------------111111--------------------11111111111----1---1--------------------------------------11111---111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11-------------1----------1----111-1-1111-----1111------1---------------------------------------------211121--------------------------------------------------------------1----------1111111111111111111-1112------------------1--1-------1111111---------1--1--------2121111-1---------11-1111111------1--111-------1--1-11111111111111111111111-1----1--1111111-111111111111-111111111111111111111111---1111111111111111-111111111---------------------------------1-1---------------------11111212111111111111111111-11111111111111---------------------------------------1-11111-1111-1111-11111-111-121--- ----------------------------------------------------1---1--------------------------------------------------------------------------------------------------------------------------------------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 274 STR:RPRED 100.0 SQ:SECSTR ccHHHHHHHHTTccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEcTTcEEEcccccHHHHHHHHHHHHHEEEHHHHHHHHHTTcEEEccccTTccccEEEEETTEEccTTccccEEEEEEEEEEEEEEEEEccTTcccccEEEEcccTTTcTTTcTTTTccccGGGEEEEEcEEEEEEEEcccEEGGGGGGEEEEEEEEEHHHHEEEETTEEEETTTTEEEEccccHHHHHHTccccHHHHHHHHHTccccHHHHTTccccHHHHHc DISOP:02AL 1-1,88-91| PSIPRED ccHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEccccccccHHHHHHHHHHHccccEEEEcHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHccEEEEcccHHHHHHHHHcccccccccccccccccHHHHHHHHHHccccHHHHHccccccccccccccccHHHccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccccccccc //