[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : nagA
DDBJ      :nagA         N-acetylglucosamine-6-phosphate deacetylase
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  559/915 : Eukaryota  128/199 : Viruses  0/175   --->[See Alignment]
b.92.1c.1.9
:383 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   33->377 3iv8A PDBj 6e-49 32.9 %
:RPS:PDB   5->377 3egjA PDBj 2e-39 27.2 %
:RPS:SCOP  5->81 1ymyA1  b.92.1.5 * 2e-07 18.4 %
:RPS:SCOP  53->348 1o12A2  c.1.9.10 * 3e-96 33.6 %
:RPS:SCOP  327->378 2qs8A1  b.92.1.9 * 5e-06 17.3 %
:HMM:SCOP  53->351 1yrrA2 c.1.9.10 * 1e-91 43.2 %
:RPS:PFM   50->365 PF01979 * Amidohydro_1 7e-06 33.6 %
:HMM:PFM   50->365 PF01979 * Amidohydro_1 2.9e-21 22.1 298/328  
:BLT:SWISS 22->377 NAGA_VIBFU 3e-55 36.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55866.1 GT:GENE nagA GT:PRODUCT N-acetylglucosamine-6-phosphate deacetylase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1866332..1867483) GB:FROM 1866332 GB:TO 1867483 GB:DIRECTION - GB:GENE nagA GB:PRODUCT N-acetylglucosamine-6-phosphate deacetylase GB:NOTE identified by match to protein family HMM PF01979; match to protein family HMM TIGR00221 GB:PROTEIN_ID ACF55866.1 GB:DB_XREF GI:194357418 GB:GENE:GENE nagA LENGTH 383 SQ:AASEQ MPNYIKADQFFYPHGVRRGGYLELVDGKFGKHVEQIPEGAEVIDYTGYSIAPGLVDTHIHGYAGVXVMDNNIEGTLHTMSEGLLSTGVTSFLPTTLTATYEQLLAVTENLGNHYKEATGAKIRGIYYEGPYFTETFKGAQNPTYMRDPGVEEFHSWQKAANGLLNKIALAPERDGVEDFVRTVTGEGVTVALGHSNATFDEAKKAVDAGASVWVHAYNGMRGLTHRELGMVGAMYQLPHTYAELICDGHHVDPKACEILIKQKGTENIALITDCMTAGGLEDGDYMLGEFPVVVANGTARLKSTGNLAGSILKLKDGLKNVVEWGIANPHEAVMMASFNPAKSVHIDDVCGQIREGYDADFIVLDKDLELVATYLDGVKRYQA GT:EXON 1|1-383:0| BL:SWS:NREP 1 BL:SWS:REP 22->377|NAGA_VIBFU|3e-55|36.3|344/399| BL:PDB:NREP 1 BL:PDB:REP 33->377|3iv8A|6e-49|32.9|340/379| RP:PDB:NREP 1 RP:PDB:REP 5->377|3egjA|2e-39|27.2|367/379| RP:PFM:NREP 1 RP:PFM:REP 50->365|PF01979|7e-06|33.6|259/271|Amidohydro_1| HM:PFM:NREP 1 HM:PFM:REP 50->365|PF01979|2.9e-21|22.1|298/328|Amidohydro_1| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01979|IPR006680| RP:SCP:NREP 3 RP:SCP:REP 5->81|1ymyA1|2e-07|18.4|76/85|b.92.1.5| RP:SCP:REP 53->348|1o12A2|3e-96|33.6|286/288|c.1.9.10| RP:SCP:REP 327->378|2qs8A1|5e-06|17.3|52/96|b.92.1.9| HM:SCP:REP 53->351|1yrrA2|1e-91|43.2|294/0|c.1.9.10|1/1|Metallo-dependent hydrolases| OP:NHOMO 837 OP:NHOMOORG 700 OP:PATTERN ----1---1111111111---------------------------------------1---1------ 111-211-111-1-11111-1---11111111-----2111--123111--1123-11--111111111111---111111-1-----2232-3-------1---1-2-4----------------------------------111111111--111111111-111111-111---1-11-1111-1111-1111111221121112111111111111211122222111-11111111111111111112111121-11111--221121111111111111111111111111111111111111111111111111111-111111111212-2--11111-11-311--------11--1111211-12122-------------------11111111111-111111--11--111111111111------111111111111111111111--1--------------------------------1--1-----111111111111111111111111--1------1---------1-------1----------------------------------------------------------------------1--2111-11-111211111-122211121111--1----------21112111222222222-2222222222222221222111111121211111111111111111122111-12222222222211-------------1-1111111111111111-----------111111111---------111111111-1334222221113322111111111111---1------11111111-----------1-1--111-11-11---11111111111-1 ------1--------2-22121111111111111111111-1111112111121111--111111----1--1-1------11111---121-11-2111--1211-1--2111111111--111113-4A1-21111-111111-11--11-11111111-1-11111111111----------1---2---11---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 383 STR:RPRED 100.0 SQ:SECSTR ccccEEccEEEccccEEccEEEEEETTEEEEGGGGccTTccEEEcTTcEEEEcEEEEEEcccTTccTTTcccHHHHHHHHHHHHTTTEEEEEEEEEcccHHHHHHHHHHHHHHHHHccccccccEEEEcccccGGGcTTccTTTcccccHHHHHHHHHTGGGEGGEEEEEcGGGccHHHHHHHHHTTcEEEEccccccHHHHHHHHHHTccEEccTTcccccccTTccHHHHHHHTcTTcEEEEccccccccHHHHHHHHHHHHGGGEEEcccccTTTTccccEEEETTEEEEEETTEEcEETTTEEccccccHHHHHHHHHHTTcccHHHHHHTTTHHHHHHHTcTTTcccccTTccccEEEEcTTccEEEEEETTcccEEc PSIPRED ccEEEEccEEEccccEEEccEEEEEccEEEEEEccccccccEEEccccEEEEccHHcccccccccccccccHHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEEEEcccccHHHHccccHHHHccccHHHHHHHHHcccccEEEEEEccccccHHHHHHHHHHcccEEEEccccccHHHHHHHHHccccEEEEccccccccccccccHHHHHHccccEEEEEEcccEEccHHHHHHHHHccccccEEEEcccccccccccccccccccEEEEEccEEEEccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHcccccccccccccccccEEEEccccEEEEEEEccEEEEcc //