[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : nanE
DDBJ      :nanE         N-acetylmannosamine-6-phosphate 2-epimerase
Swiss-Prot:NANE_STRZT   RecName: Full=Putative N-acetylmannosamine-6-phosphate 2-epimerase;         EC=5.1.3.9;AltName: Full=ManNAc-6-P epimerase;

Homologs  Archaea  0/68 : Bacteria  250/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.1.2
:232 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->232 1yxyA PDBj 3e-89 69.3 %
:RPS:PDB   3->151 3czoA PDBj 1e-15 18.0 %
:RPS:PDB   135->232 1dbtA PDBj 4e-07 12.2 %
:RPS:SCOP  13->228 1y0eA  c.1.2.5 * 1e-80 49.8 %
:HMM:SCOP  11->232 1y0eA_ c.1.2.5 * 3.8e-52 38.1 %
:RPS:PFM   43->232 PF04131 * NanE 6e-56 64.0 %
:HMM:PFM   38->232 PF04131 * NanE 2.8e-87 58.4 190/192  
:BLT:SWISS 1->232 NANE_STRZT e-130 100.0 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56846.1 GT:GENE nanE GT:PRODUCT N-acetylmannosamine-6-phosphate 2-epimerase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1535382..1536080) GB:FROM 1535382 GB:TO 1536080 GB:DIRECTION - GB:GENE nanE GB:PRODUCT N-acetylmannosamine-6-phosphate 2-epimerase GB:NOTE Steenbergen, S.M.: J Bacteriol. 2006 Sep;188(17):6195-206.; identified by match to protein family HMM PF04131 GB:PROTEIN_ID ACF56846.1 GB:DB_XREF GI:194358398 GB:GENE:GENE nanE LENGTH 232 SQ:AASEQ MPQISKEALIEQIKDGIIVSCQALPHEPLYTEAGGVIPLLVKAAEQGGAVGIRANSVRDIKEIKEVTKLPIIGIIKRDYPPQEPFITATMKEVDELAELDIEVIALDCTKRERYDGLEIQEFIRQVKEKYPNQLLMADTSIFEEGLAAVEAGIDFVGTTLSGYTSYSPKVDGPDFELIKKLCDAGVDVIAEGKIHTPEQAKQILEYGVRGIVVGGAITRPKEITERFVASLK GT:EXON 1|1-232:0| SW:ID NANE_STRZT SW:DE RecName: Full=Putative N-acetylmannosamine-6-phosphate 2-epimerase; EC=5.1.3.9;AltName: Full=ManNAc-6-P epimerase; SW:GN Name=nanE; OrderedLocusNames=SPT_1623; SW:KW Carbohydrate metabolism; Complete proteome; Isomerase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->232|NANE_STRZT|e-130|100.0|232/232| GO:SWS:NREP 2 GO:SWS GO:0005975|"GO:carbohydrate metabolic process"|Carbohydrate metabolism| GO:SWS GO:0016853|"GO:isomerase activity"|Isomerase| BL:PDB:NREP 1 BL:PDB:REP 5->232|1yxyA|3e-89|69.3|228/230| RP:PDB:NREP 2 RP:PDB:REP 3->151|3czoA|1e-15|18.0|133/521| RP:PDB:REP 135->232|1dbtA|4e-07|12.2|98/237| RP:PFM:NREP 1 RP:PFM:REP 43->232|PF04131|6e-56|64.0|189/196|NanE| HM:PFM:NREP 1 HM:PFM:REP 38->232|PF04131|2.8e-87|58.4|190/192|NanE| GO:PFM:NREP 2 GO:PFM GO:0006051|"GO:N-acetylmannosamine metabolic process"|PF04131|IPR007260| GO:PFM GO:0047465|"GO:N-acylglucosamine-6-phosphate 2-epimerase activity"|PF04131|IPR007260| RP:SCP:NREP 1 RP:SCP:REP 13->228|1y0eA|1e-80|49.8|213/222|c.1.2.5| HM:SCP:REP 11->232|1y0eA_|3.8e-52|38.1|218/0|c.1.2.5|1/1|Ribulose-phoshate binding barrel| OP:NHOMO 281 OP:NHOMOORG 251 OP:PATTERN -------------------------------------------------------------------- -----11-111-1------------------------1-------21-----111--------1-----1-----2--111------------1-----------------------------------------------------111111--111111111-11---1-1-----1----11------------------------1------------1-1111111-1-111111111111111--112-------1-111----111---11111112121--222223121221111111111111111---1111----------------1---1111---------------------1--1--------------------------1111111111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------1-----------------11--11-1111111111-1111112112111111111111----12222222221212122-11111111-111111111111------------------111-1-111111111----------------------------------------11111111---11------------------------11111111-----------1-1------11-11----11---1------ --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 230 STR:RPRED 99.1 SQ:SECSTR ##cccGGGHcHHHHHHHHHHTcccEEEEccHHHcGHHHHHHHHHHHTccccccHHHHHHHHHHHHEEccEEEcccccHHHccHHHHHHHHTTccTTHHHHHHHTTcEEEETTEEEHHHcccccccTTHHHHcEEccHHHHHHHHHHHHHHHGccEEEEEcccTTcccccccTTHHHHHHHHHHHcccEEEEEccccTTTHHHHHHHTccEEEEcTTTTGHHHHHHHHHHHHH DISOP:02AL 1-6,8-8| PSIPRED cccccHHHHHHHHcccEEEEEEEccccccccccccHHHHHHHHHHHccccEEEEccHHHHHHHHHHHcccEEEEEEccccccccEEcccHHHHHHHHHccccEEEEEcccccccccccHHHHHHHHHHHccccEEEEEcccHHHHHHHHHccccEEEEcccEEEcccccccccHHHHHHHHHHcccEEEEEcccccHHHHHHHHHccccEEEEccHHccHHHHHHHHHHHHc //