[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ndk
DDBJ      :ndk          nucleoside diphosphate kinase
Swiss-Prot:NDK_STRZP    RecName: Full=Nucleoside diphosphate kinase;         Short=NDK;         Short=NDP kinase;         EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase;

Homologs  Archaea  65/68 : Bacteria  799/915 : Eukaryota  195/199 : Viruses  1/175   --->[See Alignment]
d.58.6
:137 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->137 1ndlA PDBj 1e-35 51.5 %
:RPS:PDB   2->137 2cwkB PDBj 5e-49 44.4 %
:RPS:SCOP  1->137 1b4sA  d.58.6.1 * 2e-43 45.8 %
:HMM:SCOP  1->137 1xqiA1 d.58.6.1 * 7e-46 47.1 %
:RPS:PFM   2->137 PF00334 * NDK 4e-32 52.3 %
:HMM:PFM   2->137 PF00334 * NDK 7e-50 53.1 130/135  
:BLT:SWISS 1->137 NDK_STRZP 2e-75 99.3 %
:PROS 118->126|PS00469|NDP_KINASES

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55479.1 GT:GENE ndk GT:PRODUCT nucleoside diphosphate kinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1772464..1772877) GB:FROM 1772464 GB:TO 1772877 GB:DIRECTION - GB:GENE ndk GB:PRODUCT nucleoside diphosphate kinase GB:NOTE identified by match to protein family HMM PF00334 GB:PROTEIN_ID ACF55479.1 GB:DB_XREF GI:194357031 GB:GENE:GENE ndk LENGTH 137 SQ:AASEQ MEQTFFIIKPDGVKRGLVGEVLKRIEQRGFTIEKLEFRSQVSEELIDQHYQDLVGQSFYLPIREFMTSGPVLVGVISGPKVIETWRTMMGATRPEEALPGTIRGDFAKAAGENEVIQNVVHGSDSEESAKREIALWF GT:EXON 1|1-137:0| SW:ID NDK_STRZP SW:DE RecName: Full=Nucleoside diphosphate kinase; Short=NDK; Short=NDP kinase; EC=2.7.4.6;AltName: Full=Nucleoside-2-P kinase; SW:GN Name=ndk; OrderedLocusNames=SPP_1979; SW:KW ATP-binding; Complete proteome; Cytoplasm; Kinase; Magnesium;Metal-binding; Nucleotide metabolism; Nucleotide-binding;Phosphoprotein; Transferase. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->137|NDK_STRZP|2e-75|99.3|137/137| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0009117|"GO:nucleotide metabolic process"|Nucleotide metabolism| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 118->126|PS00469|NDP_KINASES|PDOC00409| BL:PDB:NREP 1 BL:PDB:REP 2->137|1ndlA|1e-35|51.5|130/152| RP:PDB:NREP 1 RP:PDB:REP 2->137|2cwkB|5e-49|44.4|133/152| RP:PFM:NREP 1 RP:PFM:REP 2->137|PF00334|4e-32|52.3|130/134|NDK| HM:PFM:NREP 1 HM:PFM:REP 2->137|PF00334|7e-50|53.1|130/135|NDK| GO:PFM:NREP 5 GO:PFM GO:0004550|"GO:nucleoside diphosphate kinase activity"|PF00334|IPR001564| GO:PFM GO:0005524|"GO:ATP binding"|PF00334|IPR001564| GO:PFM GO:0006183|"GO:GTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006228|"GO:UTP biosynthetic process"|PF00334|IPR001564| GO:PFM GO:0006241|"GO:CTP biosynthetic process"|PF00334|IPR001564| RP:SCP:NREP 1 RP:SCP:REP 1->137|1b4sA|2e-43|45.8|131/150|d.58.6.1| HM:SCP:REP 1->137|1xqiA1|7e-46|47.1|136/0|d.58.6.1|1/1|Nucleoside diphosphate kinase, NDK| OP:NHOMO 1596 OP:NHOMOORG 1060 OP:PATTERN 11-1111111111111-11111111111111111111111111111111111111111111111-111 1111111111111111111-111111111111111111111111111111111111111111111111111--------111111111111111--1--1-111111111111111111111112111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111113111111111111111111111-1-11-1---111111-1211----1111111---11111111111------------1-111111111----1-------1-1--111111--1--1--1111111--111111-1--121111111111111111111111111111111111-1111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111-11111111111111111111111111111111111--1111------11111111111111111-111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111121111111-11111111111111-1--------------------------11111------11 1122334-51112231111111111111111111111111111111-11111111111121111111111111111111111111111-11111112221112622124388977BA5474383AA3F6ebE-E7E4547E45CC26841723D3846699535582212211632443O2223295871583333332 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---- STR:NPRED 137 STR:RPRED 100.0 SQ:SECSTR TEEEEEEEcHHHHHTTcHHHHHHHHHHHTcEEEEEEEEccccHHHHHHHTGGGTTcTTHHHHHHHHTcccEEEEEEEEETHHHHHHHHHccccGGGccTTcHHHHHcccccccccccccEEEcccHHHHHHHHHHHc PSIPRED ccEEEEEEccHHHHcccHHHHHHHHHHcccEEEEEEEEEcccHHHHHHHHHHHHccccHHHHHHHHccccEEEEEEEcccHHHHHHHHHccccHHHcccccEEHHHHHHccccccEEEEEcccccHHHHHHHHHHHc //