[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : nrdA
DDBJ      :nrdA         ribonucleoside-diphosphate reductase, alpha subunitv
Swiss-Prot:             

Homologs  Archaea  42/68 : Bacteria  786/915 : Eukaryota  187/199 : Viruses  19/175   --->[See Alignment]
a.98.1c.7.1
:719 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->700 1peuA PDBj 0.0 50.8 %
:RPS:PDB   7->701 2bq1F PDBj e-172 50.4 %
:RPS:SCOP  11->168 1pemA1  a.98.1.1 * 2e-44 39.9 %
:RPS:SCOP  169->701 1pemA2  c.7.1.2 * e-149 53.8 %
:HMM:SCOP  8->168 1peqA1 a.98.1.1 * 1.1e-38 33.5 %
:HMM:SCOP  169->704 1peqA2 c.7.1.2 * 3.5e-165 38.2 %
:RPS:PFM   11->91 PF08343 * RNR_N 3e-19 51.9 %
:RPS:PFM   96->166 PF00317 * Ribonuc_red_lgN 4e-06 37.1 %
:RPS:PFM   171->698 PF02867 * Ribonuc_red_lgC 1e-77 40.9 %
:HMM:PFM   169->699 PF02867 * Ribonuc_red_lgC 8.9e-152 38.4 490/533  
:HMM:PFM   11->91 PF08343 * RNR_N 1.2e-32 50.6 81/82  
:HMM:PFM   95->165 PF00317 * Ribonuc_red_lgN 8.4e-12 24.3 70/83  
:BLT:SWISS 8->719 RIR1_MYCTU 0.0 51.6 %
:PROS 558->580|PS00089|RIBORED_LARGE

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56326.1 GT:GENE nrdA GT:PRODUCT ribonucleoside-diphosphate reductase, alpha subunitv GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1054835..1056994 GB:FROM 1054835 GB:TO 1056994 GB:DIRECTION + GB:GENE nrdA GB:PRODUCT ribonucleoside-diphosphate reductase, alpha subunitv GB:NOTE identified by match to protein family HMM PF00317; match to protein family HMM PF02867; match to protein family HMM PF08343; match to protein family HMM TIGR02506 GB:PROTEIN_ID ACF56326.1 GB:DB_XREF GI:194357878 GB:GENE:GENE nrdA LENGTH 719 SQ:AASEQ MGLKHLEDVTYFRLNNEINRPVNGQIMLHKDKEALDAFFKENVVPNTMVFDSIKDKINYLIEHNYIETAFIKKYRPEFLEELAQFIKDQNFQFKSFMAAYKFYNQYALKTNDGEYYLENMEDRVFFNALYFADGNEAVAIDIANEIIHQRYQPATPSFLNAGRARRGELVSCFLIQVTDDMNSIGRSINSALQLSRIGGGVGITLSNLREAGAPIKGYEGAASGVVPVMKLFEDSFSYSNQLGQRQGAGVVYLNVFHPDIIAFLSTKKENADEKVRVKTLSLGVVVPDKFYELARKNEEMYLFSPYSVEKEYGVPFNYIDITEKYDELVANPNIRKTKIKARDLETEISKLQQESGYPYVVNIDTANRANPVDGKIIMSNLCSEILQVQEPSLINDAQEFLQMGTDVSCNLGSTNVVNMMTSPDFGRSIRAMVRALTFVTDSSHIVAVPTIDHGNSQAHTFGLGAMGLHSYLAQQLIEYGSPESVEFTSIYFMLMNYWTLVESNNIARERGITFHNFEKSDYANGSYFDKYVTGEFVPTSDRVKELFKNVFIPGVADWAELRDKVQEDGLYHQNRLAVAPNGSIXYINDVSASIHPITQRIEERQEKKIGKIYYPAAGLSTETIPYYTSAYDMDMRKVIDVYAAATEHVDQGLSLTLFMRSDIPKGLYEWKRENKQTTRDLSILRNYAFNKGIKSIYYVRTFTDDGGEVGANQCESCVI GT:EXON 1|1-719:0| BL:SWS:NREP 1 BL:SWS:REP 8->719|RIR1_MYCTU|0.0|51.6|697/725| PROS 558->580|PS00089|RIBORED_LARGE|PDOC00084| BL:PDB:NREP 1 BL:PDB:REP 7->700|1peuA|0.0|50.8|681/692| RP:PDB:NREP 1 RP:PDB:REP 7->701|2bq1F|e-172|50.4|677/684| RP:PFM:NREP 3 RP:PFM:REP 11->91|PF08343|3e-19|51.9|81/81|RNR_N| RP:PFM:REP 96->166|PF00317|4e-06|37.1|70/80|Ribonuc_red_lgN| RP:PFM:REP 171->698|PF02867|1e-77|40.9|479/506|Ribonuc_red_lgC| HM:PFM:NREP 3 HM:PFM:REP 169->699|PF02867|8.9e-152|38.4|490/533|Ribonuc_red_lgC| HM:PFM:REP 11->91|PF08343|1.2e-32|50.6|81/82|RNR_N| HM:PFM:REP 95->165|PF00317|8.4e-12|24.3|70/83|Ribonuc_red_lgN| GO:PFM:NREP 12 GO:PFM GO:0004748|"GO:ribonucleoside-diphosphate reductase activity"|PF08343|IPR013554| GO:PFM GO:0005515|"GO:protein binding"|PF08343|IPR013554| GO:PFM GO:0005971|"GO:ribonucleoside-diphosphate reductase complex"|PF08343|IPR013554| GO:PFM GO:0006260|"GO:DNA replication"|PF08343|IPR013554| GO:PFM GO:0055114|"GO:oxidation reduction"|PF08343|IPR013554| GO:PFM GO:0004748|"GO:ribonucleoside-diphosphate reductase activity"|PF00317|IPR013509| GO:PFM GO:0005524|"GO:ATP binding"|PF00317|IPR013509| GO:PFM GO:0006260|"GO:DNA replication"|PF00317|IPR013509| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00317|IPR013509| GO:PFM GO:0004748|"GO:ribonucleoside-diphosphate reductase activity"|PF02867|IPR000788| GO:PFM GO:0005971|"GO:ribonucleoside-diphosphate reductase complex"|PF02867|IPR000788| GO:PFM GO:0006260|"GO:DNA replication"|PF02867|IPR000788| RP:SCP:NREP 2 RP:SCP:REP 11->168|1pemA1|2e-44|39.9|158/162|a.98.1.1| RP:SCP:REP 169->701|1pemA2|e-149|53.8|515/520|c.7.1.2| HM:SCP:REP 8->168|1peqA1|1.1e-38|33.5|161/162|a.98.1.1|1/1|R1 subunit of ribonucleotide reductase, N-terminal domain| HM:SCP:REP 169->704|1peqA2|3.5e-165|38.2|523/525|c.7.1.2|1/1|PFL-like glycyl radical enzymes| OP:NHOMO 1350 OP:NHOMOORG 1034 OP:PATTERN 11----1111111111-1111111111--22---1--------111--1-111---11-111111-11 2111221111111111122-211112222221222211112--1111211111211111122122122222-111111--1-111221221211--1--21211121221111111111111111-----------111--32312111-111----------11-------------------111111-111112221122222112111112212111111111111111111111111111111112111-1-11-2-1-11111111111111122221221111111111111122222222222221111111111---1111-111111112--11111-1112---111--1-1111111-11123-211211111--1--111-1---11111111111---------1-21111111-111----1211-2111111111111111211111221111111111111111111111111111111111111111111111111111122111111122222211212222222243121111222221111111111111111-111111-1111111121211211211211111111111111111111111111112211211111111111111111111111111--111111-11122121222222222222-222222222222222222222222222222222222213222222222222112223222332221111111111111212211111111111--11111111111112122221111111112111111111111121121111111211221111111111111111---------1--1-11111111---11-11111111111---1-111111111-- 1111111-311-111111-111111111111111111111111111111111111111111122222212122222212222222211-111111111111114231131123222111111111--1-291-112111-1111111--11112111111643111-111111221111H1111121241112241115 ---1-1-1--------1--1-1-11-----------21-1--------------------------------------------------------------------------1-----------1---------------------------------1---1-----1111- STR:NPRED 712 STR:RPRED 99.0 SQ:SECSTR ######ccccHHHHHHGGGccccccccTHHHHHHHHHHHHHTTGGGccccccHHHHHHHHHHTTcccHHHHTTccHHHHHHHHHHHHHTccccccHHHHHHHHHHTccccTTcccccccHHHHHHHHHHHHHTTcHHHHHHHHHHHHTTcEEEcHHHHTTcccccccccccEEEEEccccHHHHHHHHHHHHHHHTTTcEEEEEcTTcccTTcccTTccccccccHHHHHHHHHHHHHcTTTTcccccEEEEEETTcTTHHHHTTccccccccTTcccccEEEEEccTHHHHHHHTccEEEEEcHHHHHHHHcccGGGccccTTHHHHHHcccccEEEEEHHHHHHHHHHHHHHHcccEEEcHHHHHHHcccccccccccTTccccccccccEEcTTccEEEccccEEccEEEEcHHHHHHcccHHHHHHHHHHHHHHHHTTccccccHHHHHHHHHHcccEEccccHHHHHHHTTccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccGGGcHHHHTTTTTTTcccccccccHHHHHHHHTcccccTTHHHHHHHHHHHHcccccccccccccccGGGTTTcccccccccccEEEEccTTTccEEEEcTTcccccGGGcccHHHHcHHHHHHHHHHHHHHccccccccEEEcTTcGHHTTTcccccHccHHHHHHHHHHHHHHTccEEccEEEHHTccTTEEEETTTTEE# DISOP:02AL 1-6| PSIPRED ccccccccccEEEEccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHcccccHHHHHHccHHHHHHHHHHHcHHHHccccHHHHHHHHHHHHHccccccEEEccHHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEcccHHcccccccccEEEEEEEEcccccHHHHHHHHHHHHHHHHHccEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccEEEEEEEccHHHHHHHHHHHccccccHHHHccccHHccccHHHHHHHHccccEEEEcccccHHccccccccHHHHHHHHHHHHcccEEEEEEEHHHHHHHHHHHHHHHcccEEEEHHHHHHcccccccEEEEcccEEEEEcccccccccccccccccccccccHHHccHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccEEEcccHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccHHHEEEEcccHHHHHHHccccccccccccEEEEEEcccccEEEccccccHHHHHHcccHHHccHHHHHHHHHHHHHHHHccEEEEEEEccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccc //