[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : nrdG
DDBJ      :nrdG         anaerobic ribonucleoside-triphosphate reductase activating protein
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  327/915 : Eukaryota  1/199 : Viruses  6/175   --->[See Alignment]
c.1.28d.350.1
:196 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->180 3cb8A PDBj 9e-09 27.6 %
:RPS:PDB   41->173 2bw2A PDBj 1e-11 9.9 %
:RPS:SCOP  41->127 2h7aA1  d.350.1.1 * 1e-06 10.6 %
:HMM:SCOP  41->106 1tv8A_ c.1.28.3 * 5.6e-06 26.2 %
:HMM:PFM   40->107 PF04055 * Radical_SAM 1.5e-06 26.5 68/166  
:BLT:SWISS 20->165 NRDG_PASMU 4e-35 46.2 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56875.1 GT:GENE nrdG GT:PRODUCT anaerobic ribonucleoside-triphosphate reductase activating protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 191157..191747 GB:FROM 191157 GB:TO 191747 GB:DIRECTION + GB:GENE nrdG GB:PRODUCT anaerobic ribonucleoside-triphosphate reductase activating protein GB:NOTE identified by match to protein family HMM PF04055; match to protein family HMM TIGR02491 GB:PROTEIN_ID ACF56875.1 GB:DB_XREF GI:194358427 GB:GENE:GENE nrdG LENGTH 196 SQ:AASEQ MNNPKPQEWKSEELSQGRIIDYKAFNFVDGEGVRNSLYVAGCMFHCEGCYNVATWSFNAGIPYTAELEEQIMADLAQPYVQGLTLLGGEPFLNTGILLPLVKRIRKELSDKDIWSWTGYTWEEMMLETPDKLELLSLIDILVDGRYDRTKRNLMLQFRGSSNQRIIDVQKSLKSGQVVIWDKLNDGKESYEQVKRE GT:EXON 1|1-196:0| BL:SWS:NREP 1 BL:SWS:REP 20->165|NRDG_PASMU|4e-35|46.2|145/158| BL:PDB:NREP 1 BL:PDB:REP 17->180|3cb8A|9e-09|27.6|156/244| RP:PDB:NREP 1 RP:PDB:REP 41->173|2bw2A|1e-11|9.9|131/140| HM:PFM:NREP 1 HM:PFM:REP 40->107|PF04055|1.5e-06|26.5|68/166|Radical_SAM| RP:SCP:NREP 1 RP:SCP:REP 41->127|2h7aA1|1e-06|10.6|85/109|d.350.1.1| HM:SCP:REP 41->106|1tv8A_|5.6e-06|26.2|65/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 384 OP:NHOMOORG 336 OP:PATTERN ---------------------------------11--------------------------------- -------1---------------------------------1------------1------1-1-------11111111111------1111-111--------------------------------------------------11-1--11-------------1111-------------------1-1-111122222222222--33--2221----11222212--111111111111111111-111-1111111111111121111111111111111111111111111111111111111111111111111--11233333232321111211121111-211-11211--11------11-----------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------11---------------------1-------------------1-------------1----------------111-------11111111111111111111-------------11111111111111111-111111111111111111111111111111111111111111111111111--111111111111---------------------111-1122-111-------------111-----------------------11111111111111----------------------------------1------------------1------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------- ---1---------------1----------------11-1----------------------------------------------------------------------------------------------------------------------------1---------- STR:NPRED 192 STR:RPRED 98.0 SQ:SECSTR ###ccGGGGcccTTccccTTcTTTccccTTEEcccccEEEEEEEEEEEEEEEEcccccEEEEEEEEEEEEHHHHHHHcTTcEEEEEETTEEEEEEEcccccTGGGTcccEEEETTTEEEEccccccTTTGcccccccccccTTTccHHHHHHHHHccccccHHHHHHHHHHHHEccHHHHHHHHHHHTTcccccH# DISOP:02AL 1-10,192-192,194-197| PSIPRED cccccHHHHHHHHHcccEEccEEEEEEEccccEEEEEEEccccccccccccHHHHcccccEEccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHccccEEEEccccccHHHHHccHHHHHHHHHccEEEEcccccccccccccccccccHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHcc //