[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : nrdH
DDBJ      :nrdH         NrdH-redoxin
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  187/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.47.1
:72 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   2->71 1r7hA PDBj 3e-12 40.0 %
:RPS:PDB   2->68 2ct6A PDBj 3e-07 13.4 %
:RPS:SCOP  2->72 1h75A  c.47.1.1 * 2e-24 33.8 %
:HMM:SCOP  1->72 1h75A_ c.47.1.1 * 8e-16 31.9 %
:RPS:PFM   2->53 PF00462 * Glutaredoxin 2e-05 34.6 %
:HMM:PFM   2->53 PF00462 * Glutaredoxin 4.1e-18 44.2 52/60  
:BLT:SWISS 1->72 NRDH_LACLM 3e-22 58.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56407.1 GT:GENE nrdH GT:PRODUCT NrdH-redoxin GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 1054536..1054754 GB:FROM 1054536 GB:TO 1054754 GB:DIRECTION + GB:GENE nrdH GB:PRODUCT NrdH-redoxin GB:NOTE identified by match to protein family HMM PF00462; match to protein family HMM TIGR02194 GB:PROTEIN_ID ACF56407.1 GB:DB_XREF GI:194357959 GB:GENE:GENE nrdH LENGTH 72 SQ:AASEQ MVTVYSKNNCVQCKMTKRFLDSNNVSYREINLDEQPEYVDQVKELGFSAAPVIQTPTEVFSGFQPGKLKQLA GT:EXON 1|1-72:0| BL:SWS:NREP 1 BL:SWS:REP 1->72|NRDH_LACLM|3e-22|58.3|72/72| BL:PDB:NREP 1 BL:PDB:REP 2->71|1r7hA|3e-12|40.0|70/74| RP:PDB:NREP 1 RP:PDB:REP 2->68|2ct6A|3e-07|13.4|67/111| RP:PFM:NREP 1 RP:PFM:REP 2->53|PF00462|2e-05|34.6|52/60|Glutaredoxin| HM:PFM:NREP 1 HM:PFM:REP 2->53|PF00462|4.1e-18|44.2|52/60|Glutaredoxin| GO:PFM:NREP 3 GO:PFM GO:0009055|"GO:electron carrier activity"|PF00462|IPR002109| GO:PFM GO:0015035|"GO:protein disulfide oxidoreductase activity"|PF00462|IPR002109| GO:PFM GO:0045454|"GO:cell redox homeostasis"|PF00462|IPR002109| RP:SCP:NREP 1 RP:SCP:REP 2->72|1h75A|2e-24|33.8|71/76|c.47.1.1| HM:SCP:REP 1->72|1h75A_|8e-16|31.9|72/76|c.47.1.1|1/1|Thioredoxin-like| OP:NHOMO 194 OP:NHOMOORG 187 OP:PATTERN -------------------------------------------------------------------- -----111---11111111-11111211111111112232-----11-1---111111--------------111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1-11-1---11111111111211111111111111111111111111111111-11111111111111-------------------------------------------------------------------------------------------------------11-111---------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11---111111111--1-1111111111111111111-1111-1-1111111111111111111-11111-11111111-111----------------1---------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 71 STR:RPRED 98.6 SQ:SECSTR EEEEEEccccccHHHHHHHHHHTTccEEEEETTTcHHHHHHHHHcccTTTccccccccccEEEETTEEHHH# PSIPRED cEEEEEccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHccccccEEEEccEEEEcccHHHHHHcc //