[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : nusA
DDBJ      :nusA         transcription termination factor NusA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  908/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
b.40.4d.202.1d.52.3
:378 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->353 1hh2P PDBj 4e-68 41.0 %
:RPS:PDB   40->139 2abjA PDBj 3e-15 10.1 %
:RPS:PDB   129->230 2cqoA PDBj 2e-11 15.8 %
:RPS:PDB   248->354 2cxcA PDBj 1e-22 25.0 %
:RPS:SCOP  1->123 1hh2P4  d.202.1.1 * 2e-34 40.7 %
:RPS:SCOP  132->198 1k0rA1  b.40.4.5 * 1e-15 28.4 %
:RPS:SCOP  200->271 1hh2P2  d.52.3.1 * 2e-17 50.0 %
:RPS:SCOP  292->357 1hh2P3  d.52.3.1 * 2e-10 53.0 %
:HMM:SCOP  1->126 1hh2P4 d.202.1.1 * 5.7e-36 41.3 %
:HMM:SCOP  131->198 1k0rA1 b.40.4.5 * 8e-18 39.7 %
:HMM:SCOP  199->290 1hh2P2 d.52.3.1 * 1.7e-22 44.9 %
:HMM:SCOP  292->358 1k0rA3 d.52.3.1 * 7.8e-19 50.7 %
:RPS:PFM   4->125 PF08529 * NusA_N 3e-20 41.0 %
:HMM:PFM   4->123 PF08529 * NusA_N 1.3e-39 44.2 120/122  
:HMM:PFM   245->265 PF00013 * KH_1 1.7e-06 47.6 21/57  
:HMM:PFM   321->362 PF00013 * KH_1 0.00022 34.3 35/57  
:HMM:PFM   133->192 PF00575 * S1 3e-08 28.3 60/74  
:BLT:SWISS 1->378 NUSA_BACHD 1e-87 44.6 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56743.1 GT:GENE nusA GT:PRODUCT transcription termination factor NusA GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 485190..486326 GB:FROM 485190 GB:TO 486326 GB:DIRECTION + GB:GENE nusA GB:PRODUCT transcription termination factor NusA GB:NOTE identified by match to protein family HMM PF00575; match to protein family HMM PF08529; match to protein family HMM TIGR01953 GB:PROTEIN_ID ACF56743.1 GB:DB_XREF GI:194358295 GB:GENE:GENE nusA LENGTH 378 SQ:AASEQ MSKEMLEAFRILEEDKGIKKEDIIDAVVESLRSAYRRRYGQSDSVAIDFNEKTGDFTVYTVREVVDEVFDSRLEISLKDALAINSAYELGDKIKFEEAPAEFGRVAAQSAKQTIMEKMRKQTRAITYNTYKEHEQEIMSGTVERFDNRFIYVNLGSIEAQLSKQDQIPGEVFASHDRIEVYVYKVEDNPRGVNVFVSRSHPEMIKRLMEQEIPEVYDGTVEIMSVAREAGDRTKVAVRSHNPNVDAIGTIVGRGGANIKKITSKFHPARYDAKNDRMVPIEENIDVIEWVADPAEFIYNAIAPAEVDQVIFDENDSKRALVVVPXNKLSLAIGRRGQNVRLAAHLTGYRIDIKSASEFEAMEDAASVELEVENDTVEE GT:EXON 1|1-378:0| BL:SWS:NREP 1 BL:SWS:REP 1->378|NUSA_BACHD|1e-87|44.6|363/382| BL:PDB:NREP 1 BL:PDB:REP 1->353|1hh2P|4e-68|41.0|339/344| RP:PDB:NREP 3 RP:PDB:REP 40->139|2abjA|3e-15|10.1|99/366| RP:PDB:REP 129->230|2cqoA|2e-11|15.8|95/119| RP:PDB:REP 248->354|2cxcA|1e-22|25.0|92/138| RP:PFM:NREP 1 RP:PFM:REP 4->125|PF08529|3e-20|41.0|122/122|NusA_N| HM:PFM:NREP 4 HM:PFM:REP 4->123|PF08529|1.3e-39|44.2|120/122|NusA_N| HM:PFM:REP 245->265|PF00013|1.7e-06|47.6|21/57|KH_1| HM:PFM:REP 321->362|PF00013|0.00022|34.3|35/57|KH_1| HM:PFM:REP 133->192|PF00575|3e-08|28.3|60/74|S1| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF08529|IPR013735| GO:PFM GO:0005515|"GO:protein binding"|PF08529|IPR013735| GO:PFM GO:0031554|"GO:regulation of transcription termination"|PF08529|IPR013735| RP:SCP:NREP 4 RP:SCP:REP 1->123|1hh2P4|2e-34|40.7|123/126|d.202.1.1| RP:SCP:REP 132->198|1k0rA1|1e-15|28.4|67/76|b.40.4.5| RP:SCP:REP 200->271|1hh2P2|2e-17|50.0|72/78|d.52.3.1| RP:SCP:REP 292->357|1hh2P3|2e-10|53.0|66/68|d.52.3.1| HM:SCP:REP 1->126|1hh2P4|5.7e-36|41.3|126/126|d.202.1.1|1/1|Transcription factor NusA, N-terminal domain| HM:SCP:REP 131->198|1k0rA1|8e-18|39.7|68/0|b.40.4.5|1/1|Nucleic acid-binding proteins| HM:SCP:REP 199->290|1hh2P2|1.7e-22|44.9|78/0|d.52.3.1|1/1|Prokaryotic type KH domain (KH-domain type II)| HM:SCP:REP 292->358|1k0rA3|7.8e-19|50.7|67/67|d.52.3.1|2/2|Prokaryotic type KH domain (KH-domain type II)| OP:NHOMO 913 OP:NHOMOORG 912 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---1-1-1---------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 378 STR:RPRED 100.0 SQ:SECSTR HHHHHHHHHHHHcHccccccGGGGGcTTccHHHHHHHHTcHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHTTcEEEEEEEETTTEEEEEEEEEETTEEETEcTTGGGTTHHHHHHHHHHHHHHTTcccccTTcEEEEEEEccHHHHHTTcEEcEEEEEcGGGccTTccccTTcEEEEEEEEEEccccccEEEEEcccHHHHHHHHHHHcHHHHTTcEEEEEEEEETTTEEEEEEEEccTTccHHHHHHcGGGHHHHHHHHHcccGGHHHHHHHHHTHccEEEEEEccccHHHHHHHHcTTccEEEEEEEETTEEEEEEEEcTTTHHHHHcGGGHHHHHHHHHHHHHHcEEEcccccccccHHHHHHHHHHHHHHH DISOP:02AL 1-1,376-379| PSIPRED ccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccccccEEEEEEEEEccccccccccccHHHHHHHccccccccEEEEEccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccEEEEEEcccEEEEcHHHHccccccccccEEEEEEEEEEEcccccEEEEEEccHHHHHHHHHHHcHHHHccEEEEEEEEEccccEEEEEEEEccccccEEEEEEccccHHHHHHHHHHccccccccccccccccccEEEEEccccHHHHHHHHcccEEEEEEEEEcccccEEEEEEcHHHccHHcccccHHHHHHHHHHccEEEEEEHHHHHHHHHHHHHHHHHHcccccc //