[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : nusG
DDBJ      :nusG         transcription termination/antitermination factor NusG
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  902/915 : Eukaryota  3/199 : Viruses  0/175   --->[See Alignment]
b.34.5d.58.42
:178 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   6->118 2k06A PDBj 4e-22 39.6 %
:BLT:PDB   130->177 1nz9A PDBj 1e-08 41.7 %
:RPS:PDB   59->169 2ckkA PDBj 1e-20 8.7 %
:RPS:SCOP  6->118 1nz8A  d.58.42.1 * 2e-31 41.8 %
:RPS:SCOP  126->178 1m1gA2  b.34.5.4 * 1e-10 34.0 %
:HMM:SCOP  5->119 1nz8A_ d.58.42.1 * 1.3e-32 49.1 %
:HMM:SCOP  123->178 1m1gA2 b.34.5.4 * 1.4e-13 37.5 %
:RPS:PFM   8->107 PF02357 * NusG 2e-22 59.6 %
:HMM:PFM   7->106 PF02357 * NusG 2.5e-27 52.4 84/92  
:HMM:PFM   130->157 PF00467 * KOW 7.6e-10 39.3 28/32  
:BLT:SWISS 1->178 NUSG_STRP8 9e-83 80.3 %

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56190.1 GT:GENE nusG GT:PRODUCT transcription termination/antitermination factor NusG GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1824866..1825402) GB:FROM 1824866 GB:TO 1825402 GB:DIRECTION - GB:GENE nusG GB:PRODUCT transcription termination/antitermination factor NusG GB:NOTE identified by match to protein family HMM PF00467; match to protein family HMM PF02357; match to protein family HMM TIGR00922 GB:PROTEIN_ID ACF56190.1 GB:DB_XREF GI:194357742 GB:GENE:GENE nusG LENGTH 178 SQ:AASEQ MDSFDKGWFVLQTYSGYENKVKENLLQRAQTYNMLDNILRVEIPTQTVQVEKNGKRKEVEENRFPGYVLVEMVMTDEAWFVVRNTPNVTGFVGSHGNRSKPTPLLEQEIRDILVSMGQTVQEFDFDVEIGQTVRIIDGAFADYTGKITEIDNNKVKMIISMFGNDTVAEVNLNQIAEL GT:EXON 1|1-178:0| BL:SWS:NREP 1 BL:SWS:REP 1->178|NUSG_STRP8|9e-83|80.3|178/179| BL:PDB:NREP 2 BL:PDB:REP 6->118|2k06A|4e-22|39.6|111/123| BL:PDB:REP 130->177|1nz9A|1e-08|41.7|48/58| RP:PDB:NREP 1 RP:PDB:REP 59->169|2ckkA|1e-20|8.7|104/120| RP:PFM:NREP 1 RP:PFM:REP 8->107|PF02357|2e-22|59.6|89/92|NusG| HM:PFM:NREP 2 HM:PFM:REP 7->106|PF02357|2.5e-27|52.4|84/92|NusG| HM:PFM:REP 130->157|PF00467|7.6e-10|39.3|28/32|KOW| GO:PFM:NREP 2 GO:PFM GO:0003711|"GO:transcription elongation regulator activity"|PF02357|IPR006645| GO:PFM GO:0032968|"GO:positive regulation of RNA elongation from RNA polymerase II promoter"|PF02357|IPR006645| RP:SCP:NREP 2 RP:SCP:REP 6->118|1nz8A|2e-31|41.8|110/119|d.58.42.1| RP:SCP:REP 126->178|1m1gA2|1e-10|34.0|53/58|b.34.5.4| HM:SCP:REP 5->119|1nz8A_|1.3e-32|49.1|112/0|d.58.42.1|1/1|N-utilization substance G protein NusG, N-terminal domain| HM:SCP:REP 123->178|1m1gA2|1.4e-13|37.5|56/58|b.34.5.4|1/1|Translation proteins SH3-like domain| OP:NHOMO 911 OP:NHOMOORG 905 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111211111111121111111111111111111111111111111111111111-111111111111111111111111111111111121111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-111111-111111-1-1111111111111111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------1-----2---- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 173 STR:RPRED 97.2 SQ:SECSTR #####cEEEEEEEcTTcHHHHHHHHHHHHHHHTcTTTcccccccccccccccccccTTcccccccTTcEEEEcccTTcGGGTTcEEEEEEEETTTEEEccEEETTTccEEEEEGGGEEEccccccTccTTcEEEEcccTTTTcEEEEEEEEGGGTEEEcccTTTTcEEETTTEEEcEc DISOP:02AL 1-2,117-120| PSIPRED cccccccEEEEEEEcccHHHHHHHHHHHHHHccccccEEEEEccEEEEEEEEccEEEEEEEEccccEEEEEEEEcHHHHHHHHcccccEEEEEccccccccEEccHHHHHHHHHHccccccccccccccccEEEEEEccccccEEEEEEEcccEEEEEEEEccccEEEEEcHHHcEEc //