[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : pcpA
DDBJ      :pcpA         choline binding protein PcpA
Swiss-Prot:             

Homologs  Archaea  2/68 : Bacteria  39/915 : Eukaryota  3/199 : Viruses  4/175   --->[See Alignment]
b.109.1c.10.2
:601 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   310->394 2z64A PDBj 7e-04 32.1 %
:BLT:PDB   464->600 2vyuA PDBj 2e-46 60.3 %
:RPS:PDB   308->396 3ciyA PDBj 2e-06 21.3 %
:RPS:PDB   464->600 2bibA PDBj 3e-28 48.9 %
:RPS:SCOP  326->389 1gwbA  c.10.2.7 * 2e-05 37.5 %
:RPS:SCOP  456->600 2bibA1  b.109.1.1 * 4e-53 47.6 %
:HMM:SCOP  132->396 1xkuA_ c.10.2.7 * 8.3e-15 28.2 %
:HMM:SCOP  456->600 2bibA1 b.109.1.1 * 3.5e-55 51.7 %
:HMM:PFM   464->481 PF01473 * CW_binding_1 9.9e-09 61.1 18/19  
:HMM:PFM   483->501 PF01473 * CW_binding_1 2.1e-09 63.2 19/19  
:HMM:PFM   503->521 PF01473 * CW_binding_1 2.1e-09 63.2 19/19  
:HMM:PFM   523->541 PF01473 * CW_binding_1 2.1e-09 63.2 19/19  
:HMM:PFM   543->561 PF01473 * CW_binding_1 2.1e-09 63.2 19/19  
:HMM:PFM   563->580 PF01473 * CW_binding_1 7.3e-06 44.4 18/19  
:BLT:SWISS 203->379 BSL1_TRIVA 4e-11 26.0 %
:BLT:SWISS 465->590 LYS_BPCP1 5e-29 47.6 %
:REPEAT 6|464->483|484->503|504->523|524->543|544->563|564->583
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55277.1 GT:GENE pcpA GT:PRODUCT choline binding protein PcpA GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1960549..1962354) GB:FROM 1960549 GB:TO 1962354 GB:DIRECTION - GB:GENE pcpA GB:PRODUCT choline binding protein PcpA GB:NOTE identified by match to protein family HMM PF01473 GB:PROTEIN_ID ACF55277.1 GB:DB_XREF GI:194356829 GB:GENE:GENE pcpA LENGTH 601 SQ:AASEQ MKKTTILSLTTAAVILAAYVPNEPILADTPSSEVIKETKVGSIIQQNNIKYKVLTVEGNIGTVQVGNGVTPVEFEAGQDGKPFTIPTKITVGDKVFTVTEVASQAFSYYPDETGRIVYYPSSITIPSSIKKIQKKGFHGSKAKTIIFDKGSQLEKIEDRAFDFSELEEIELPASLEYIGTSAFXFSQKLKKLTFSSSSKLELISHEAFANLSNLEKLTLPKSVKTLGSNLFXLTTSXKHVDVEEGNESFASVDGVLFSKDKTQLIYYPSQKNDESYKTPKETKELASYSFNKNSYLKKLELNEGLEKIGTFAFADAIKLEEISLPNSLETIERLAFYGNLELKELILPDNVKNFGKHVMNGLPKLKSLTIGNNINSLPSFFLSGVLDSLKEIHIKNKSTEFSVKKDTFAIPETVKFYVTSEHIKDVLKSNLSTSNDIIVEKVDNIKQETDVAKPKKNSNQGVVGWVKDKGLWYYLNESGSMATGWVKDKGLWYYLNESGSMATGWVKDKGLWYYLNESGSMATGWVKDKGLWYYLNESGSMATGWVKDKGLWYYLNESGSMATGWFTVSGKWYYTYNSGDLLVNTTTPDGYRVNANGEWVG GT:EXON 1|1-601:0| BL:SWS:NREP 2 BL:SWS:REP 203->379|BSL1_TRIVA|4e-11|26.0|177/625| BL:SWS:REP 465->590|LYS_BPCP1|5e-29|47.6|126/339| NREPEAT 1 REPEAT 6|464->483|484->503|504->523|524->543|544->563|564->583| SEG 121->135|ssitipssikkiqkk| SEG 183->200|fxfsqklkkltfsssskl| SEG 296->307|lkklelneglek| BL:PDB:NREP 2 BL:PDB:REP 310->394|2z64A|7e-04|32.1|84/599| BL:PDB:REP 464->600|2vyuA|2e-46|60.3|136/300| RP:PDB:NREP 2 RP:PDB:REP 308->396|3ciyA|2e-06|21.3|89/661| RP:PDB:REP 464->600|2bibA|3e-28|48.9|137/540| HM:PFM:NREP 6 HM:PFM:REP 464->481|PF01473|9.9e-09|61.1|18/19|CW_binding_1| HM:PFM:REP 483->501|PF01473|2.1e-09|63.2|19/19|CW_binding_1| HM:PFM:REP 503->521|PF01473|2.1e-09|63.2|19/19|CW_binding_1| HM:PFM:REP 523->541|PF01473|2.1e-09|63.2|19/19|CW_binding_1| HM:PFM:REP 543->561|PF01473|2.1e-09|63.2|19/19|CW_binding_1| HM:PFM:REP 563->580|PF01473|7.3e-06|44.4|18/19|CW_binding_1| RP:SCP:NREP 2 RP:SCP:REP 326->389|1gwbA|2e-05|37.5|64/265|c.10.2.7| RP:SCP:REP 456->600|2bibA1|4e-53|47.6|145/232|b.109.1.1| HM:SCP:REP 132->396|1xkuA_|8.3e-15|28.2|174/0|c.10.2.7|1/1|L domain-like| HM:SCP:REP 456->600|2bibA1|3.5e-55|51.7|145/0|b.109.1.1|1/1|Cell wall binding repeat| OP:NHOMO 341 OP:NHOMOORG 48 OP:PATTERN --------------------------------------------------21---------------- ------------------------------------------------------------------------------36-L-----------------------------------------------------------------------------------------------------------------------1--11-----------1------1-------------------------------------------1--4----2---------322DBBEDDDBCFA-------------1------------1p-------X-Z-2---5642------2--1----1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------1-------------------------------------------------1-----2---------------------------------- ---------------1---------------------------------------------------------1---------------------------------------------------1-1----------------------------------------------- STR:NPRED 285 STR:RPRED 47.4 SQ:SECSTR ###################################################################################################################################################################################################################################################################################################################TTGGGGGGGccccEEEccccccEEcTTTTTTcTTccEEEccccccEEcGGGGTTcccccEEEcTcccccccEEcTTTTcTTccEEEccc#########ccEEEEETTEEEEEEcccTEEcccEEEEEcccccccccccEEEEEEEEEEcEEETTTEEEEEccccEEEEcTTcccccEEEEccccEEEEcTTcccccEEEEETTEEEEEcTTcccccEEEEETTEEEEEcTTcccccEEEEETTEEEEEcTTcccccEEEEETTEEEEEcTTccccccEEcTTccEEcTTccccT DISOP:02AL 1-3| PSIPRED ccccEEEHHHHHHHHHHHcccccccccccccccccEEEEEccEEEEccccccEEEccccccEEEcccccEEEcccccccccEEEEcccEEEcccEEEEEEEcccccccccHHHHHHcccccEEEEcccEEEccccHHcccccccEEEcccccEEEEccHHcccccEEEEEEccccEEcccHHccccccccEEEccccccEEEEccHHHcccccccEEEccccccccccHHHccccccEEEEcccccHHHHHHcccccccccccEEEccccccccEEEccccccccccHHHcccccccEEEccccEEEcccHHHccccccEEEEcccccEEcccccccccccccEEEccccHHHccHHHHHccccccEEEccccHHcccHHHHcccHHccEEEccccccEEEEEcccEEEEccccccccccEEEcccccccccccccEEEEccccccccccEEEcccccccEEEEEEEEccEEEEEcccccccccEEEEccEEEEEcccccEEEEEEEEccEEEEEcccccEEEEEEEEccEEEEEcccccEEEEEEEEccEEEEEcccccEEEEEEEEcccEEEEcccccEEEEEEEEccEEEcccccccc //