[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : pcrA
DDBJ      :pcrA         ATP-dependent DNA helicase PcrA
Swiss-Prot:             

Homologs  Archaea  21/68 : Bacteria  905/915 : Eukaryota  98/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:763 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->644 3pjrA PDBj 0.0 58.4 %
:RPS:PDB   5->436 3e1sA PDBj 1e-73 7.9 %
:RPS:PDB   448->736 1b77A PDBj 2e-25 10.0 %
:RPS:SCOP  8->647 1qhh.1  c.37.1.19 * e-102 59.2 %
:HMM:SCOP  1->650 1qhh.1 c.37.1.19 * 1.9e-170 41.1 %
:RPS:PFM   12->426 PF00580 * UvrD-helicase 2e-99 47.1 %
:HMM:PFM   8->488 PF00580 * UvrD-helicase 2.5e-146 39.7 481/533  
:HMM:PFM   444->599 PF04257 * Exonuc_V_gamma 2.9e-06 21.7 152/1016  
:BLT:SWISS 1->761 PCRA_LEUCI 0.0 57.6 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55659.1 GT:GENE pcrA GT:PRODUCT ATP-dependent DNA helicase PcrA GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 969164..971455 GB:FROM 969164 GB:TO 971455 GB:DIRECTION + GB:GENE pcrA GB:PRODUCT ATP-dependent DNA helicase PcrA GB:NOTE identified by match to protein family HMM PF00580; match to protein family HMM TIGR01073 GB:PROTEIN_ID ACF55659.1 GB:DB_XREF GI:194357211 GB:GENE:GENE pcrA LENGTH 763 SQ:AASEQ MNALLNGMNDRQAEAVQTTEGPLLIMAGAGSGKTRVLTHRIAYLIDEKLVNPWNILAITFTNKAAREMKERAYSLNPATQDCLIATFHSMCVRILRRDADHIGYNRNFTIVDPGEQRTLMKRILKQLNLDPKKWNERTILGTISNAKNDLIDDVAYAAQAGDMYTQIVAQCYTAYQKELRQSESVDFDDLIMLTLRLFDQNPDVLTYYQQKFQYIHVDEYQDTNHAQYQLVKLLASRFKNICVVGDADQSIYGWRGADMQNILDFEKDYPKAKVVLLEENYRSTKTILQAANEVIKNNKNRRPKNLWTQNADGEQIVYYRADDELDEAVFVARTIDELSRSQNFLHKDFAVLYRTNAQSRTIEEALLKSNIPYTMVGGTKFYSRKEIRDIIAYLNLIANLSDNISFERIINEPKRGIGLGTVXKIRDFANLQNMSMLDASANIMLSGIKGKAAQSIWDFANMMLDLREQLDHLSITELVESVLEKTGYVDILNTQATLESKARVENIEEFLSVTKNFDDTTDVTEEETGLDKLSRFLNDLALIADTDSGSQETSEVTLMTLHAAKGLEFPVVFLIGMEENVFPLSRATEDPDELEEERRLAYVGITRAEKILYLTNANSRLLFGRTNYNRPTRFINEISSDLLEYQGLARPANTSFKASYSSGSISFXQGMSLAQAXQDRKRGAAPKSIQSSGLPFGQFTAGAKPASSEANWSIGDIALHKKWGEGTVLEVSGSGARQELKINFPEVGLKKLLASVAPIEKKI GT:EXON 1|1-763:0| BL:SWS:NREP 1 BL:SWS:REP 1->761|PCRA_LEUCI|0.0|57.6|740/749| SEG 518->528|ddttdvteeet| SEG 589->600|edpdeleeerrl| BL:PDB:NREP 1 BL:PDB:REP 4->644|3pjrA|0.0|58.4|634/646| RP:PDB:NREP 2 RP:PDB:REP 5->436|3e1sA|1e-73|7.9|431/517| RP:PDB:REP 448->736|1b77A|2e-25|10.0|221/228| RP:PFM:NREP 1 RP:PFM:REP 12->426|PF00580|2e-99|47.1|414/449|UvrD-helicase| HM:PFM:NREP 2 HM:PFM:REP 8->488|PF00580|2.5e-146|39.7|481/533|UvrD-helicase| HM:PFM:REP 444->599|PF04257|2.9e-06|21.7|152/1016|Exonuc_V_gamma| GO:PFM:NREP 4 GO:PFM GO:0003677|"GO:DNA binding"|PF00580|IPR000212| GO:PFM GO:0004003|"GO:ATP-dependent DNA helicase activity"|PF00580|IPR000212| GO:PFM GO:0005524|"GO:ATP binding"|PF00580|IPR000212| GO:PFM GO:0006281|"GO:DNA repair"|PF00580|IPR000212| RP:SCP:NREP 1 RP:SCP:REP 8->647|1qhh.1|e-102|59.2|610/623|c.37.1.19| HM:SCP:REP 1->650|1qhh.1|1.9e-170|41.1|621/0|c.37.1.19|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 2240 OP:NHOMOORG 1024 OP:PATTERN -------------------------12-2312312--1--311-3122-12-2-------------2- 1231433333332333322-22222222222233333333345533323333333333334444435443543334332232111211122111111--11311222241222222222222222-1111221123233331112111132211233111111211111211111222121122111122245333333323243345333333233312112332222222223222222222232222222222222222222222112221112222222222222222332232222222222222222222222222223354555334444434443444244435431133212226222222122222111122222223222112222211111111111-12114121232122212322222212231111211321111111111321212111111222221112222222222222111111112333233322222222222233222323234334511753223222633344243222222222222331232233322222522223222432322333333313223222222322222222232223322242542232322332223322232222321-2222211111233323333333333453-33333333333333333322233333343333333333533333333333331232222222222--3222222233332533422322222222222322232223223232232232232223233222233222323533333343432222323222222222135544552221211132311111-11111111112112211112222211111212 1-11--2-311---1111111111-11-------------------11-111111111-1--122232111121122-2212211111-11111111111111311-163---------------------------------3--------------2----1---------11232181-11-1113114-2----1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 695 STR:RPRED 91.1 SQ:SECSTR HTcTHHTTcccHHHHHHHHHcHHHHHHHHHTccccEEHHHHHHHHHHHHcccHHHHHHHHHHHHHHTccEEEcccccccccccEEEcHHHHHHHHHHHHHHHHHHHccccccccccccccTTTTTTccHHHHHHHHHHTTccEEEEEccTHHHHHHHHHHHHTTccEEEEEccHHHHHHHHHHHTccEEEHHHHTTEETTEEcccccccccccEEEEccGGGccHHHHHHHHTTccTTcEEEEEEcTTcccccccccHHHHHHHHccEEEcccccHHHHTcHHHHHHHHHHTTcccccccTTEEEEEcccTTcHHHHHHHHHHTTcGGGcEEEEcccccTTcHHHHHHHHHHHHccccccEEccccEEcTTcEEEEccccTTTTccTTcEEEEEEEccccEEEEETTEEEEEcGGGGTTEEEccEEEHHHHTTccEHHHcTTccEEEEEccTTccHHHHHHHHTTccEEEHHHHHHHHHHTcccTTccHHHHHHHEEETTEEEGGGHHHHHHHHTTccTTcEEEccHHEcTTccEEEEccccEEEEccccccccccGGGcccccccccccccEEETcccEEEEEcHTcccHHHHHHHHHHHHTTccEEEEEEETTEEEEEHEEcTTTcTTcccccEEEEEEEcccc######cccEEEEEEGGGcccccc###################################cEEEEEEEETTEEEEEccccEEEEEccTTcE########################### DISOP:02AL 590-591,651-665,680-711| PSIPRED ccHHHHcccHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHHccccHHHEEEEEccHHHHHHHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHccccEEEEccHHHccHHHHHHHHHHHccccEEEEEccccccccccccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHcccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHHHcccccHHHEEEEEccHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHcccccccccccEEEEEHHHcccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHcccccEEEEEEEcccccccccccccccHHHHHccHHHHHHHcccccccccccccccccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccEEEccccccEEEEEEEcccccEEEEEEcccccEEEEEccccccEEcc //