[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : pfkA
DDBJ      :pfkA         6-phosphofructokinase
Swiss-Prot:K6PF_STRPI   RecName: Full=6-phosphofructokinase;         Short=Phosphofructokinase;         EC=2.7.1.11;AltName: Full=Phosphohexokinase;

Homologs  Archaea  4/68 : Bacteria  543/915 : Eukaryota  188/199 : Viruses  0/175   --->[See Alignment]
c.89.1
:335 amino acids
:SECSTR
:PSIPRED
:BLT:PDB   1->335 6pfkA PDBj e-110 62.9 %
:RPS:PDB   2->279 3edcA PDBj 2e-25 16.6 %
:RPS:SCOP  1->335 1mtoA  c.89.1.1 * 5e-91 61.9 %
:HMM:SCOP  1->310 1kzhA_ c.89.1.1 * 5.9e-110 50.3 %
:RPS:PFM   3->274 PF00365 * PFK 2e-64 52.4 %
:HMM:PFM   2->277 PF00365 * PFK 8.1e-129 62.0 276/282  
:BLT:SWISS 1->335 K6PF_STRPI 0.0 100.0 %
:PROS 244->262|PS00433|PHOSPHOFRUCTOKINASE
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56069.1 GT:GENE pfkA GT:PRODUCT 6-phosphofructokinase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 800513..801520 GB:FROM 800513 GB:TO 801520 GB:DIRECTION + GB:GENE pfkA GB:PRODUCT 6-phosphofructokinase GB:NOTE identified by match to protein family HMM PF00365; match to protein family HMM TIGR02482 GB:PROTEIN_ID ACF56069.1 GB:DB_XREF GI:194357621 GB:GENE:GENE pfkA LENGTH 335 SQ:AASEQ MKRIAVLTSGGDAPGMNAAIRAVVRQAISEGMEVFGIYDGYAGMVAGEIHPLDAASVGDIISRGGTFLHSARYPEFAQLEGQLKGIEQLKKHGIEGVVVIGGDGSYHGAMRLTEHGFPAIGLPGTIDNDIVGTDFTIGFDTAVTTAMDAIDKIRDTSSSHRRTFVIEVMGRNAGDIALWAGIATGADEIIIPEADFKMEDIVASIKAGYECGKKHNIIVLAEGVMSAAEFGQKLKEAGDTSDLRVTELGHIQRGGSPTARDRVLASRMGAHAVKLLKEGIGGVAVGIRNEKMVENPILGTAEEGALFSLTAEGKIVVNNPHKADIELSSLNKSLS GT:EXON 1|1-335:0| SW:ID K6PF_STRPI SW:DE RecName: Full=6-phosphofructokinase; Short=Phosphofructokinase; EC=2.7.1.11;AltName: Full=Phosphohexokinase; SW:GN Name=pfkA; OrderedLocusNames=SPH_1003; SW:KW ATP-binding; Complete proteome; Cytoplasm; Glycolysis; Kinase;Magnesium; Metal-binding; Nucleotide-binding; Transferase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->335|K6PF_STRPI|0.0|100.0|335/335| GO:SWS:NREP 7 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0006096|"GO:glycolysis"|Glycolysis| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| PROS 244->262|PS00433|PHOSPHOFRUCTOKINASE|PDOC00336| SEG 93->104|giegvvviggdg| BL:PDB:NREP 1 BL:PDB:REP 1->335|6pfkA|e-110|62.9|318/319| RP:PDB:NREP 1 RP:PDB:REP 2->279|3edcA|2e-25|16.6|277/300| RP:PFM:NREP 1 RP:PFM:REP 3->274|PF00365|2e-64|52.4|271/282|PFK| HM:PFM:NREP 1 HM:PFM:REP 2->277|PF00365|8.1e-129|62.0|276/282|PFK| GO:PFM:NREP 3 GO:PFM GO:0003872|"GO:6-phosphofructokinase activity"|PF00365|IPR000023| GO:PFM GO:0005945|"GO:6-phosphofructokinase complex"|PF00365|IPR000023| GO:PFM GO:0006096|"GO:glycolysis"|PF00365|IPR000023| RP:SCP:NREP 1 RP:SCP:REP 1->335|1mtoA|5e-91|61.9|318/319|c.89.1.1| HM:SCP:REP 1->310|1kzhA_|5.9e-110|50.3|310/0|c.89.1.1|1/1|Phosphofructokinase| OP:NHOMO 1167 OP:NHOMOORG 735 OP:PATTERN -----------------2-------------------------1--22-------------------- 131-211111111111111-11112-1111111111111112222-111111121111--11-21113321-------1-1-21-1113345-311---11112111122---------------1121211222422233---212122222-111------121-121-------------11111222111111111111111111211111111111-111111111111111111111111111111111-2112-11111--11111---11111111111111111111111111111111111111141111111211131111111111211113332111112222222222112211123111-1-----------1--1-----------------------------1-----------------------------------------111--------------------------------1----------------------------------------11-111--1----2--------------11--1121211211--111133322232111112332--------------------11111--1111--112-2-------------------1------11111111111111111111111-1111111111111111111222221111111111111111111211111111-111111111111111-222221111-1---111111111111111---------------------------------------11111111111111----------------11111111---1--11--111111---1111111111111111123222232221-2 --11111-211-1111111111121221111111111111111111211111111111111112222212322222213222222211-1211111111111122211113896953323233334273Dp4-965222363351-331132233633213A42111311223112221H2221275651622-11--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 335 STR:RPRED 100.0 SQ:SECSTR ccEEEEEEEccccHHHHHHHHHHHHHHHHHTcEEEEEEEcTTcHHHHHHHHHHHTTccEEEEEccccHHHHHHHHHHTTTccEEEccccTTccccEEEEcHHHHHHHHHHHHHHHTcccEEEEEccTTcHHHHHHHHHHHHHHHHTccccEEEEccccHHHHHHHHHHHccccEEEEccHHHHHHHHEHHHHHTTcccTTTcEEEEEEccGGGGGcccccEEEEccHHHHHHHHHHHEEEEccEEEcccccccTTccTTcHHHHHHHHHHHHHHTTccccTTEEEEETTTEEEEccTcccccGGGcccTTTGGGcEEEcTTccEEEGGGcHHHHT PSIPRED ccEEEEEEccccccHHHHHHHHHHHHHHHcccEEEEEcccHHHHHcccEEEccHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHHccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHHHHHHHHcccccccccccccHHccccccHHHHHHHHHHHHHHHHHHHcccccEEEEEEccEEEEccHHHHHHHHccccHHHHHHHHcccHHHccHHHHHHHHHcc //