[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : pflA
DDBJ      :pflA         pyruvate formate-lyase 1-activating enzyme
Swiss-Prot:             

Homologs  Archaea  7/68 : Bacteria  337/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
c.1.28d.218.1d.350.1
:264 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   11->251 3cb8A PDBj 5e-61 47.2 %
:RPS:PDB   11->258 3c8fA PDBj 4e-29 43.8 %
:RPS:SCOP  31->132 2h7aA1  d.350.1.1 * 2e-12 15.2 %
:RPS:SCOP  137->234 2o5aA1  d.218.1.12 * 1e-24 22.2 %
:HMM:SCOP  27->233 1tv8A_ c.1.28.3 * 1.2e-23 27.0 %
:RPS:PFM   32->197 PF04055 * Radical_SAM 2e-12 34.4 %
:HMM:PFM   32->197 PF04055 * Radical_SAM 1.6e-33 32.7 159/166  
:BLT:SWISS 4->263 PFLA_STRMU e-124 77.3 %
:PROS 26->47|PS01087|RADICAL_ACTIVATING

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55574.1 GT:GENE pflA GT:PRODUCT pyruvate formate-lyase 1-activating enzyme GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1791331..1792125) GB:FROM 1791331 GB:TO 1792125 GB:DIRECTION - GB:GENE pflA GB:PRODUCT pyruvate formate-lyase 1-activating enzyme GB:NOTE identified by match to protein family HMM PF04055; match to protein family HMM TIGR02493 GB:PROTEIN_ID ACF55574.1 GB:DB_XREF GI:194357126 GB:GENE:GENE pflA LENGTH 264 SQ:AASEQ MSEETIDYGQVTGMVHSTESFGSVDGPGIRFIVFLQGCHMRCQYCHNPDTWAMESNKSRERTVDDVLTEALRYRGFWGNKGGITVSGGEALLQIDFLIALFTKAKEQGIHCTLDTCALPFRNKPRYLEKFDKLMAVTDLVLLDIKEINEEQHKIVTSQTNKNILACAQYLSDIGKPVWIRHVLVPGLTDRDDDLIELGKFVKTLKNVDKFEILPYHTMGEFKWRELGIPYSLEGVKPPTADRVKNAKQLMDTESYQDYMKRVHG GT:EXON 1|1-264:0| BL:SWS:NREP 1 BL:SWS:REP 4->263|PFLA_STRMU|e-124|77.3|260/263| PROS 26->47|PS01087|RADICAL_ACTIVATING|PDOC00834| BL:PDB:NREP 1 BL:PDB:REP 11->251|3cb8A|5e-61|47.2|235/244| RP:PDB:NREP 1 RP:PDB:REP 11->258|3c8fA|4e-29|43.8|242/245| RP:PFM:NREP 1 RP:PFM:REP 32->197|PF04055|2e-12|34.4|157/164|Radical_SAM| HM:PFM:NREP 1 HM:PFM:REP 32->197|PF04055|1.6e-33|32.7|159/166|Radical_SAM| GO:PFM:NREP 2 GO:PFM GO:0003824|"GO:catalytic activity"|PF04055|IPR007197| GO:PFM GO:0051536|"GO:iron-sulfur cluster binding"|PF04055|IPR007197| RP:SCP:NREP 2 RP:SCP:REP 31->132|2h7aA1|2e-12|15.2|99/109|d.350.1.1| RP:SCP:REP 137->234|2o5aA1|1e-24|22.2|90/108|d.218.1.12| HM:SCP:REP 27->233|1tv8A_|1.2e-23|27.0|196/0|c.1.28.3|1/1|Radical SAM enzymes| OP:NHOMO 697 OP:NHOMOORG 353 OP:PATTERN -----------------------1---------1-11---------------------1-1---1--- -----11-----------------------------------------1-------------1-1------11111111--1------2232-3-------------------------------------------------1--2-1----11----------1----------------------111-1-111111111111111--11--1111----21111111-1111111111111111111--1---11-----22--1111----11122222222222222222222222222222222222221112222-6313444444454414334112312-1111--44-421112-----112-----------------1---3--1------------------------------------------------------------------2----------------------------------1---------11---------------------------------------------1-----------1-1-6212-3231311--12--11-2-------------------------------1----412-------11222212211121222222--1----------42111314445455544-4444445454454444445243121134343434433434334144444441-211111111111------------------111111122121111---------------------------------------11121111123222----------------------------------2-------------------------------1-----1 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------1151111---------4----- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 95.5 SQ:SECSTR ##########ccEEEEEEEEEEcTTcccEEEEEEEcccccccTTcccGGGccTTEEccEEEcHHHHHHHHGGGHHHHTcTTcEEEEEccGGGGHHHHHHHHHHHHTTTccEEEEEccccccccccHHHHHHHHHHTccEEEEEcccccHHHHHHHHccccHHHHHHHHHHHHHTccEEEEEEEcTTTTccHHHHHHHHHHHHHHccEEEEEEEEcccccHHHHHHTTcccTTTTcccccHHHHHHHHHHHHTTTccccHcTT## DISOP:02AL 1-6,264-265| PSIPRED ccccccccccEEEEEccEEEEEEEccccEEEEEEEccccccccccccHHHccccccccccccHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEEcccccccccccHHHHHHHHHHccEEEEEcccccHHHHHHHccccHHHHHHHHHHHHHccccEEEEEEEEccccccHHHHHHHHHHHHHcccccEEEEEccccccccHHHHccccccccccccccHHHHHHHHHHHHHccccEEEccccc //