[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : pgdA
DDBJ      :pgdA         peptidoglycan GlcNAc deacetylase (pgdA)
Swiss-Prot:             

Homologs  Archaea  3/68 : Bacteria  360/915 : Eukaryota  100/199 : Viruses  0/175   --->[See Alignment]
c.6.2d.341.1
:445 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   28->445 2c1gA PDBj 0.0 98.7 %
:RPS:PDB   28->445 2c1gA PDBj 4e-38 89.1 %
:RPS:SCOP  28->249 2c1gA2  d.341.1.1 * 1e-22 99.5 %
:RPS:SCOP  250->445 2c1gA1  c.6.2.3 * 1e-50 97.4 %
:HMM:SCOP  28->249 2c1iA2 d.341.1.1 * 9.4e-80 45.9 %
:HMM:SCOP  250->445 2c1iA1 c.6.2.3 * 5.6e-62 45.1 %
:RPS:PFM   249->360 PF01522 * Polysacc_deac_1 6e-24 43.2 %
:HMM:PFM   246->359 PF01522 * Polysacc_deac_1 4.6e-37 42.5 113/124  
:HMM:PFM   1->43 PF10883 * DUF2681 0.00012 30.8 39/78  
:BLT:SWISS 6->429 YJEA_BACSU 2e-49 33.9 %
:TM
:COIL

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55764.1 GT:GENE pgdA GT:PRODUCT peptidoglycan GlcNAc deacetylase (pgdA) GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1361080..1362417) GB:FROM 1361080 GB:TO 1362417 GB:DIRECTION - GB:GENE pgdA GB:PRODUCT peptidoglycan GlcNAc deacetylase (pgdA) GB:NOTE Vollmer, W. (2000)J.Biol. Chem. 275, 20496-20501.; identified by similarity to GB:CAB96552.1; match to protein family HMM PF01522 GB:PROTEIN_ID ACF55764.1 GB:DB_XREF GI:194357316 GB:GENE:GENE pgdA LENGTH 445 SQ:AASEQ MALIGILAISICLLGGFIAFKIYQQKSFEQKIESLKKEKDDQLSEGNQKEHFRQGQAEVIAYYPLQGEKVISSVRELINQDVKDKLESKDNLVFYYTEQEESGLKGVVNRNVTKQIYDLVAFKIEETEKTSLGKVHLTEDGQPFTLDQLFSDASKAKEQLIKELTSFIEDKKIEQDQSEQIVKNFSDQDLSAWNFDYKDSQIILYPSPVVENLEEIALPVSAFFDVIQSSYLLEKDAALYQSYFDKKHQKVVALTFDDGPNPATTPQVLETLAKYDIKATFFVLGKNVSGNEDLVKRIKSEGHVVGNHSWSHPILSQLSLDEAKKQITDTEDVLTKVLGSSSKLMRPPYGAITDDIRNSLDLSFIMWDVDSLDWKSKNXASILTXIXHQVANGSIXLMHDIHSPTVNALPRXIEYLKNQGYTFVTIPEMLNTRLKAHELYYSRDE GT:EXON 1|1-445:0| BL:SWS:NREP 1 BL:SWS:REP 6->429|YJEA_BACSU|2e-49|33.9|404/467| COIL:NAA 18 COIL:NSEG 1 COIL:REGION 155->172| TM:NTM 1 TM:REGION 2->24| BL:PDB:NREP 1 BL:PDB:REP 28->445|2c1gA|0.0|98.7|384/384| RP:PDB:NREP 1 RP:PDB:REP 28->445|2c1gA|4e-38|89.1|384/384| RP:PFM:NREP 1 RP:PFM:REP 249->360|PF01522|6e-24|43.2|111/123|Polysacc_deac_1| HM:PFM:NREP 2 HM:PFM:REP 246->359|PF01522|4.6e-37|42.5|113/124|Polysacc_deac_1| HM:PFM:REP 1->43|PF10883|0.00012|30.8|39/78|DUF2681| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF01522|IPR002509| GO:PFM GO:0016810|"GO:hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds"|PF01522|IPR002509| RP:SCP:NREP 2 RP:SCP:REP 28->249|2c1gA2|1e-22|99.5|188/188|d.341.1.1| RP:SCP:REP 250->445|2c1gA1|1e-50|97.4|196/196|c.6.2.3| HM:SCP:REP 28->249|2c1iA2|9.4e-80|45.9|222/0|d.341.1.1|1/1|Peptidoglycan deacetylase N-terminal noncatalytic region| HM:SCP:REP 250->445|2c1iA1|5.6e-62|45.1|193/0|c.6.2.3|1/1|Glycoside hydrolase/deacetylase| OP:NHOMO 1386 OP:NHOMOORG 463 OP:PATTERN --------------------------------------------------111--------------- 232-711-------21111-1122111111111111111-1332-1--1---121-----2232-1-7853-222----2121-----1113-111----1222-22211---------------------1----12222111-2322122-22--------1-113352------------2231111-556A9A9AABB8AAABCA666685AAC54676241111129B--------------------2-1-11---------111-----1121111111111111111111111111111111111111---11112468A66666666664A885777744-162352446533343322321-12--1--------1164442344443--------------1--2---11-111-2211221144----1------1--------------1--11-----------------------1111--11-1-----1222121------12------211111---111-1----1111-1-11--------------11112-------1--1111-1-------11---1-1-------------------------11----111----------------------1-------------------------------------------------------------------------------------------------------------1------------------------------1-----1--------1--------------------------22222222222222-------------------------1-------------------------1-1111-1 ---1--------OM913865332353322222242533233332225434776788A44344111111112111122222111111---4343G8944455C4PEV------------------------------------------------------------------------------1--1-8-1--2111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 418 STR:RPRED 93.9 SQ:SECSTR ###########################cHHHHHHHHHHHHHHHcTTEEEEEEEETTEEEEEEEEEETTEEcHHHHHHHHHHHHHTcccccEEEEEEEEEEEcccTTEEEEEEEEEEEEccccccEEEEEEEEEEEEEETTcccccGGGGcccHHHHHHHHHHHHHHcccEEEETTEEEEccEEEEGGGGTTTccGGGccHHHHHHHHHHHHHGGGccEEEEEEEEEcTTccccGGGTccHHHHHHHHccEEEEEEEEccccTTHHHHHHHHHHHTTcccEEEEcHHHHHHcHHHHHHHHHTTcEEEEcccccccGGGccHHHHHHHHHHHHHHHHHTTcccccEEccGGGcccHHHHHHTTcEEccccEEccGGGTccHHHHHHHHHHTccTTcEEEEEcccHHHHHHHHHHHHHHHHTTEEEcEEcTTTcGGccTTcEEccccc DISOP:02AL 1-1,25-48,170-182,439-441,443-446| PSIPRED cHHHHHHHHHHHHHHHHHHHHEEccccccccccccHHHHHHHccccEEEEEEEccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHEEEHHHHccccccccEEEEEEEEEEcccEEEcccccccHHEEEEccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccHHcccEEccccEEEEEEcccccccccEEEEEEEEEEcccccccccccccccccccccccccEEEEEEccccccccHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHHcccEEEEcccccccHHcccHHHHHHHHHHHHHHHHHHccccccEEEcccccccHHHHHHccccEEEEEccccccccccHHHHHHHHHHccccccEEEEEcccHHHHHHHHHHHHHHHHcccEEEEHHHHHccccccccccccccc //