[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : pgsA
DDBJ      :pgsA         CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  814/915 : Eukaryota  19/199 : Viruses  0/175   --->[See Alignment]
:181 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   6->112 PF01066 * CDP-OH_P_transf 4.1e-21 28.4 95/102  
:BLT:SWISS 47->167 PGSA_BACSU 1e-33 59.2 %
:BLT:SWISS 152->180 COX3_ACACA 1e-04 41.4 %
:PROS 51->73|PS00379|CDP_ALCOHOL_P_TRANSF
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55925.1 GT:GENE pgsA GT:PRODUCT CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(2058455..2059000) GB:FROM 2058455 GB:TO 2059000 GB:DIRECTION - GB:GENE pgsA GB:PRODUCT CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase GB:NOTE identified by match to protein family HMM PF01066; match to protein family HMM TIGR00560 GB:PROTEIN_ID ACF55925.1 GB:DB_XREF GI:194357477 GB:GENE:GENE pgsA LENGTH 181 SQ:AASEQ MKKEQIPNLLTIGRILFIPIFIFILTIGNSIESHIVAAIIFAVASITDYLDGYLARKWNVVSNFGKFADPMADKLLVMSAFIMLIELGMAPAWIVAVIICRELAVTGLRLLLVETGGTILAAAMPGKIKTFSQMFAIIFLLLHWTLLGQVLLYVALFFTIYSGYDYFKGSAYVFKGTFGSK GT:EXON 1|1-181:0| BL:SWS:NREP 2 BL:SWS:REP 47->167|PGSA_BACSU|1e-33|59.2|120/193| BL:SWS:REP 152->180|COX3_ACACA|1e-04|41.4|29/329| PROS 51->73|PS00379|CDP_ALCOHOL_P_TRANSF|PDOC00321| TM:NTM 3 TM:REGION 16->38| TM:REGION 75->97| TM:REGION 136->158| SEG 11->28|tigrilfipififiltig| SEG 35->46|ivaaiifavasi| HM:PFM:NREP 1 HM:PFM:REP 6->112|PF01066|4.1e-21|28.4|95/102|CDP-OH_P_transf| OP:NHOMO 889 OP:NHOMOORG 833 OP:PATTERN -------------------------------------------------------------------- 1121111111111111111-11111111111111111111-11111111112111111111112111122222221121222111222--------------------1-111111111111112211111---1112211---1-1111111----1---1-11-111111-111-1-111------2212111111111111111111111111111111111111111121111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112222111111111112111111112111-111-11111121--2222-11-11---111111111111111111111111111111-111111-122111111111111-112-111-1111111111111111111111-1111111111111111111111111111111-11111111111121111111111111111111111111111111111111111111111-11111111111111111111111112111111112111111111112111111111111111111111111111111-2111111-1111111111111111211-12111------11111111111111111-1111111111111111111111111111111111111111111111111111-1------------11111111111111211---111111-111111111111111111111--111111-11--11111111111111111111111111111111111111111111111111111111-11111-1-111-1111111111111111111111111111 -----------1-------------------------------------------------------------------------------------------------------1---------------------------------------------------3--1----1-21-1-12-1123-211-1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-1,180-182| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //