[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : potA
DDBJ      :potA         spermidine/putrescine ABC transporter, ATP-binding protein
Swiss-Prot:POTA_STRR6   RecName: Full=Spermidine/putrescine import ATP-binding protein potA;         EC=3.6.3.31;

Homologs  Archaea  68/68 : Bacteria  909/915 : Eukaryota  198/199 : Viruses  1/175   --->[See Alignment]
b.40.6c.37.1
:385 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   4->286 2yyzA PDBj 3e-69 49.3 %
:RPS:PDB   4->229 3b5jA PDBj 2e-53 24.7 %
:RPS:SCOP  5->241 1b0uA  c.37.1.12 * 1e-52 32.1 %
:RPS:SCOP  242->346 3d31A1  b.40.6.3 * 5e-11 19.2 %
:HMM:SCOP  3->238 1g2912 c.37.1.12 * 2.5e-75 42.3 %
:HMM:SCOP  240->345 1oxsC1 b.40.6.3 * 2.3e-14 28.0 %
:RPS:PFM   47->166 PF00005 * ABC_tran 7e-28 52.9 %
:HMM:PFM   47->165 PF00005 * ABC_tran 3.4e-28 36.8 114/118  
:HMM:PFM   276->345 PF08402 * TOBE_2 4.9e-09 22.1 68/75  
:HMM:PFM   18->65 PF03193 * DUF258 4e-08 29.8 47/161  
:BLT:SWISS 1->385 POTA_STRR6 0.0 99.7 %
:PROS 138->152|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56568.1 GT:GENE potA GT:PRODUCT spermidine/putrescine ABC transporter, ATP-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1297117..1298274) GB:FROM 1297117 GB:TO 1298274 GB:DIRECTION - GB:GENE potA GB:PRODUCT spermidine/putrescine ABC transporter, ATP-binding protein GB:NOTE Ware, D.; (2005) J.Microb. 43:398-405; identified by match to protein family HMM PF00005; match to protein family HMM PF08402 GB:PROTEIN_ID ACF56568.1 GB:DB_XREF GI:194358120 GB:GENE:GENE potA LENGTH 385 SQ:AASEQ MKKPIIEFKNVSKVFEDSNTKVLKDINFELEEGKFYTLLGASGSGKSTILNIIAGLLDATTGDIMLDGVRINDIPTNKRDVHTVFQSYALFPHMNVFENVAFPLRLRKIDKKEIEQRVAEVLKMVQLEGYEKRSIRKLSGGQRQRVAIARAIINQPRVVLLDEPLSALDLKLRTDMQYELRELQQRLGITFVFVTHDQEEALAMSDWIFVMNDGEIVQSGTPVDIYDEPINHFVATFIGESNILPGTMIEDYLVEFNGKRFEAVDGGMKPNEPVEVVIRPEDLRITLPEEGKLQVKVDTQLFRGVHYEIIAYDELGNEWMIHSTRKAIVGEEIGLDFESEDIHIMRLNETEEEFDARIEEYVEIEEQEAGLINAIEEERDEENKL GT:EXON 1|1-385:0| SW:ID POTA_STRR6 SW:DE RecName: Full=Spermidine/putrescine import ATP-binding protein potA; EC=3.6.3.31; SW:GN Name=potA; OrderedLocusNames=spr1246; SW:KW ATP-binding; Cell membrane; Complete proteome; Hydrolase; Membrane;Nucleotide-binding; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->385|POTA_STRR6|0.0|99.7|385/385| GO:SWS:NREP 6 GO:SWS GO:0005524|"GO:ATP binding"|ATP-binding| GO:SWS GO:0005886|"GO:plasma membrane"|Cell membrane| GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| GO:SWS GO:0016020|"GO:membrane"|Membrane| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 138->152|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 359->368|eeyveieeqe| BL:PDB:NREP 1 BL:PDB:REP 4->286|2yyzA|3e-69|49.3|278/358| RP:PDB:NREP 1 RP:PDB:REP 4->229|3b5jA|2e-53|24.7|223/243| RP:PFM:NREP 1 RP:PFM:REP 47->166|PF00005|7e-28|52.9|119/123|ABC_tran| HM:PFM:NREP 3 HM:PFM:REP 47->165|PF00005|3.4e-28|36.8|114/118|ABC_tran| HM:PFM:REP 276->345|PF08402|4.9e-09|22.1|68/75|TOBE_2| HM:PFM:REP 18->65|PF03193|4e-08|29.8|47/161|DUF258| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 2 RP:SCP:REP 5->241|1b0uA|1e-52|32.1|234/258|c.37.1.12| RP:SCP:REP 242->346|3d31A1|5e-11|19.2|104/119|b.40.6.3| HM:SCP:REP 3->238|1g2912|2.5e-75|42.3|234/240|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 240->345|1oxsC1|2.3e-14|28.0|100/0|b.40.6.3|1/1|MOP-like| OP:NHOMO 58427 OP:NHOMOORG 1176 OP:PATTERN aaOEVONQcbcXbXdTrMXWSVTc*PTmqbkaMEFEGFJIJGFWbWcsNR**m9UgVWcQVNOIe1AB af*R*injsswbiWdYXSR-RmCCc*SSSSSS*wwx****Z*e****j*tmV***SanHH***o******jhggg*ihjS*nqCCEBDaaYP6SIMO1-LIYPROoTfVZACAABACCDCDDDDLWSOVeRPYYcXv****NMO*e*v**ssvjmZbUQUQUOjreq***jPYLQPRPVNPKPqflVS*qCcl*************************mt***sx********dstusuqorssssrrelhjk*oik**kVler**VV**icWfsqooszz**xv******z*xv**x**hhhggikklkjgh*zxljlwvytx***********m*q****ipol*zo***qxWO***rbhjsUdpjywSlikQjZYYPOQPMQja***fXy****************-v**rp*u***WG**************OPQ**********ZYZZZZZZ*ejOVod*77678888668AABDEBCDCABAAB96B6NEFIFF************************u********BQ****q*sy******euyTaOWsjKMMLOMLYWTezrj**Wle*qcrzigtPigeYYepbdgefiy*b*SPPVIQQQSPLDFEFEEFEEMZIJOUT*w*Y*YlOYS*VbefbRZlaXXZaaiebjf5-HOaUP331544****d************-************************xvp**w*z*****yz*z*y**wy****a6************55MKEGDEFQSTSWQ*x*gfeeecOUXUSZRXkSTWVTKXKSX*k*************q***IIHGGJHGIPpvu*y*zz******YYaTVUTTVWJIII8ARXYYOPQQCB9BCBBB*EfFEEDK-GHHHPJFTUPDKTGJKBBCgs*dcz**xxGmR 4466yqS1qQGFbmaOKRKJRVSaMaPNNFIGHPQNENIKJIIHFFOOQVVTcUOOTGKIHIJCGAED2EFAIGHEI3INDGFFNN9C-PfFKNIPGCEIJCKWVQBZuz*emgxpvSMPJRdO**J*K**w4*Z*PPQKqJQ*kKUQKFkHJ*LfXa*Nu*Y*XmI*jv*lquZKQMI*PQMNZ****M**UT****g ------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------ DISOP:02AL 1-2,362-386| PSIPRED ccccEEEEEEEEEEEccccEEEEEccEEEEccccEEEEEccccccHHHHHHHHHccccccccEEEEccEEcccccHHHccEEEEEEcccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHcccHHHccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHHHHHHHHcccEEEEEccHHHHHHHccEEEEEEccEEEEEccHHHHHHccccHHHHHHcccccEEEEEEEccEEEEEccEEEEccccccccccEEEEEEcccEEEEEcccccEEEEEEEEEEEEccEEEEEEEEccccEEEEEcccccccccEEEEEEcHHHEEEEcccccccHHHHHHHHHHcccHHHHHHHccccHHHHHHHcc //