[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : potB
DDBJ      :potB         spermidine/putrescine ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  621/915 : Eukaryota  4/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:268 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   8->241 3fh6F PDBj 3e-09 25.3 %
:RPS:PDB   168->202 3dhwA PDBj 9e-11 31.4 %
:RPS:SCOP  8->263 2r6gG1  f.58.1.1 * 7e-21 18.7 %
:RPS:PFM   76->221 PF00528 * BPD_transp_1 7e-09 31.2 %
:HMM:PFM   59->262 PF00528 * BPD_transp_1 1.1e-13 19.4 165/185  
:BLT:SWISS 7->261 POTB_HAEIN 6e-38 33.7 %
:TM

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55262.1 GT:GENE potB GT:PRODUCT spermidine/putrescine ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1296330..1297136) GB:FROM 1296330 GB:TO 1297136 GB:DIRECTION - GB:GENE potB GB:PRODUCT spermidine/putrescine ABC transporter, permease protein GB:NOTE Ware, D.; (2005) J.Microb. 43:398-405; identified by match to protein family HMM PF00528 GB:PROTEIN_ID ACF55262.1 GB:DB_XREF GI:194356814 GB:GENE:GENE potB LENGTH 268 SQ:AASEQ MKKTSSKLFVVPYMLWIALFVLAPLVLIFGQSFFNIEGQFSLENYKSYFASQNLTYLKMSFNSVLYAGIVTFVTLLISYPTALFLTRLKHRQLWLMLIILPTWINLLLKAYAFIGIFGQNGSINQFLEFIGIGSQQLLFTDFSFIFVASYIELPFMILPIFNVLDDMDNNLINASYDLGATKWETFRHVIFPLSMNGVRSGVQSVFIPSLSLFMLTRLIGGNRVITLGTAIEQNFLTNDNYGMGSTIGVILILTMFITMWVTKERRER GT:EXON 1|1-268:0| BL:SWS:NREP 1 BL:SWS:REP 7->261|POTB_HAEIN|6e-38|33.7|252/286| TM:NTM 5 TM:REGION 9->31| TM:REGION 63->85| TM:REGION 95->117| TM:REGION 135->157| TM:REGION 244->262| BL:PDB:NREP 1 BL:PDB:REP 8->241|3fh6F|3e-09|25.3|233/316| RP:PDB:NREP 1 RP:PDB:REP 168->202|3dhwA|9e-11|31.4|35/203| RP:PFM:NREP 1 RP:PFM:REP 76->221|PF00528|7e-09|31.2|141/195|BPD_transp_1| HM:PFM:NREP 1 HM:PFM:REP 59->262|PF00528|1.1e-13|19.4|165/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 8->263|2r6gG1|7e-21|18.7|246/284|f.58.1.1| OP:NHOMO 1582 OP:NHOMOORG 647 OP:PATTERN ----1-------------1----122223-1---1--144431-------1-------121-11---- -11-5--1-------11----1--13-----12111----11--------------------2-21-22111---11-1---1-----1111-1-------------1----------------1111---21-1-11121---23-11111112---------1-23212--------------11111--2-3231344333334334111113344332211111111742111111-111111-111113122111-12111111111-21223222211111221112111111111111111111111112221112-22112223243141142212422122141231321--22---111--3----1111-------B9A224324213344343144B---6--5-37J1-BAAE56ACACDDA4---24A849AB46--------1----114-----------------------------1---1-275426566581244399AC77673584B2131--1113311123A64E333-1--3211111-1222--11-4---31--2112121-----------23-22--11-11-------------------314-313-1--1111111111111111111----1-1------33431423333333333-333333342333333333333333--22222222222222222223222221-233333333333---1-----11111-314444344112111111222221112221655558A7655652455111111111-21212222223222111111111--------311111111111111-1311111-1111111111111-111111312313121-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------2--------------1---1------1-------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 252 STR:RPRED 94.0 SQ:SECSTR #######ccHHHHHHHHHHHTHHHHHHHHTTccccccccccccTTHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHcccccHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHTcHHHHHHHccccccccccccccccHHHHHHTTTTTHHHHHHHHHHHHH######### DISOP:02AL 1-4,268-269| PSIPRED ccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccc //