[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : potC
DDBJ      :potC         spermidine/putrescine ABC transporter, permease protein
Swiss-Prot:             

Homologs  Archaea  22/68 : Bacteria  607/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
f.58.1
:257 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   40->204 2onkC PDBj 4e-09 21.8 %
:RPS:PDB   151->186 3dhwA PDBj 3e-09 25.0 %
:RPS:SCOP  28->251 2r6gG1  f.58.1.1 * 5e-21 16.1 %
:RPS:PFM   125->206 PF00528 * BPD_transp_1 2e-09 36.6 %
:RPS:PFM   181->242 PF11025 * GP40 4e-04 37.1 %
:HMM:PFM   74->244 PF00528 * BPD_transp_1 5e-19 25.5 165/185  
:BLT:SWISS 27->253 POTC_SHIFL 2e-39 33.5 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55765.1 GT:GENE potC GT:PRODUCT spermidine/putrescine ABC transporter, permease protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1295560..1296333) GB:FROM 1295560 GB:TO 1296333 GB:DIRECTION - GB:GENE potC GB:PRODUCT spermidine/putrescine ABC transporter, permease protein GB:NOTE Ware, D.; (2005) J.Microb. 43:398-405; identified by match to protein family HMM PF00528 GB:PROTEIN_ID ACF55765.1 GB:DB_XREF GI:194357317 GB:GENE:GENE potC LENGTH 257 SQ:AASEQ MKKFANLYLGLVFLVLYLPIFYLIGYAFNAGDDMNSFTGFSWTHFETMFGDGRLMLILAQTFFLAFLSALIATIIGTFGAIYIYQSRKKYQEAFLSLNNILMVAPDVMIGASFLILFTQLKFSLGFLTVLSSHVAFSIPIVVLMVLPRLKEMNGDMIHAAYDLGASQFQMFKEIMLPYLTPSIITGYFMAFTYSLDDFAVTFFVTGNGFSTLSVEIYSRARKGISLEINALSALVFLFSIILVVGYYFISREKEEQA GT:EXON 1|1-257:0| BL:SWS:NREP 1 BL:SWS:REP 27->253|POTC_SHIFL|2e-39|33.5|227/264| TM:NTM 6 TM:REGION 7->29| TM:REGION 56->78| TM:REGION 95->117| TM:REGION 126->148| TM:REGION 174->196| TM:REGION 225->247| SEG 7->18|lylglvflvlyl| BL:PDB:NREP 1 BL:PDB:REP 40->204|2onkC|4e-09|21.8|165/252| RP:PDB:NREP 1 RP:PDB:REP 151->186|3dhwA|3e-09|25.0|36/203| RP:PFM:NREP 2 RP:PFM:REP 125->206|PF00528|2e-09|36.6|82/195|BPD_transp_1| RP:PFM:REP 181->242|PF11025|4e-04|37.1|62/165|GP40| HM:PFM:NREP 1 HM:PFM:REP 74->244|PF00528|5e-19|25.5|165/185|BPD_transp_1| GO:PFM:NREP 3 GO:PFM GO:0005215|"GO:transporter activity"|PF00528|IPR000515| GO:PFM GO:0006810|"GO:transport"|PF00528|IPR000515| GO:PFM GO:0016020|"GO:membrane"|PF00528|IPR000515| RP:SCP:NREP 1 RP:SCP:REP 28->251|2r6gG1|5e-21|16.1|224/284|f.58.1.1| OP:NHOMO 1429 OP:NHOMOORG 631 OP:PATTERN 11--------------1-111112311-21---1---1----------------131-111------- -11-2----------------2---3------1111----11-2------------------1----2111-------1---2--111111211-----------1-1----------------1---1-1-----12211---22--2---222----------113221------------1-1------1-111-12222121212112211112122211111111144122222222222221233222221111-22222111122-113111111111111112221111111111111111111111111111112-112111111111112--1231212121211-221-111--------1----1111-------57A2212242255555553558-1121111-7G1-A66B3599788994---2587388936111111111---1114-----------------------------1---1-112115445372133288AB5545256592121--1112211112741A223-1--211222222211---1-5---41--211211------------13--2--1---------1---1----1-1--213-412----12222111222212112111--1--1------32331313333333333-333333333333333333344544-123344434444343443233233332-344434444444---------11111-225444342112122111------11212165556596768663666111111111-212222222121111111111111------1222111111111111-1311111-1111211----111121112311212111-1- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 165 STR:RPRED 64.2 SQ:SECSTR #######################################TTHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccHHHHHHHHHHHHcccccTTcHHHHHHHHHHHHHHHHHHHHHHHHHHccTTTTTHHHHHTccTHHHHHHTTHHHHHHHHHHHHHHHHHHHHHccHHHHTT##################################################### DISOP:02AL 1-1,253-258| PSIPRED ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //