[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : potD
DDBJ      :potD         spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein
Swiss-Prot:             

Homologs  Archaea  8/68 : Bacteria  551/915 : Eukaryota  5/199 : Viruses  0/175   --->[See Alignment]
c.94.1
:356 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   37->331 1poy1 PDBj 7e-66 41.0 %
:RPS:PDB   35->352 1a99A PDBj 2e-44 29.6 %
:RPS:SCOP  34->353 1potA  c.94.1.1 * 9e-52 38.6 %
:HMM:SCOP  34->353 1a99A_ c.94.1.1 * 1.7e-92 35.3 %
:RPS:PFM   36->110 PF02030 * Lipoprotein_8 2e-12 46.6 %
:RPS:PFM   83->131 PF00287 * Na_K-ATPase 8e-04 32.7 %
:HMM:PFM   48->289 PF01547 * SBP_bac_1 4.2e-17 20.2 233/314  
:BLT:SWISS 33->327 POTD_SALTY 3e-66 40.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56823.1 GT:GENE potD GT:PRODUCT spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1294493..1295563) GB:FROM 1294493 GB:TO 1295563 GB:DIRECTION - GB:GENE potD GB:PRODUCT spermidine/putrescine ABC transporter, spermidine/putrescine-binding protein GB:NOTE Ware, D.; (2005) J.Microb. 43:398-405; identified by match to protein family HMM PF01547 GB:PROTEIN_ID ACF56823.1 GB:DB_XREF GI:194358375 GB:GENE:GENE potD LENGTH 356 SQ:AASEQ MKKIYSFLAGIAAIILVLWGIATHLDSKINSRDSQKLVIYNWGDYIDPELLTQFTEETGIQVQYETFDSNEAMYTKIKQGGTTYDIAIPSEYMINKMKDEDLLVPLDYSKIEGIENIGPEFLNQSFDPGNKFSIPYFWGTLGIVYNETMVDEAPEHWDDLWKPEYKNSIMLFDGAREVLGLGLNSLGYSLNSKDLQQLEETVDKLYKLTPNIKAIVADEMKGYMIQNNVAIGVTFSGEASQMLEKNENLRYVVPTEASNLWFDNMVIPKTVKNQNSAYAFINFMLKPENALQNAEYVGYSTPNLPAKELLPEETKEDKAFYPDVETMKHLEVYEKFDHKWTGKYSDLFLQFKMYRK GT:EXON 1|1-356:0| BL:SWS:NREP 1 BL:SWS:REP 33->327|POTD_SALTY|3e-66|40.3|295/348| TM:NTM 1 TM:REGION 5->27| SEG 179->192|lglglnslgyslns| BL:PDB:NREP 1 BL:PDB:REP 37->331|1poy1|7e-66|41.0|295/323| RP:PDB:NREP 1 RP:PDB:REP 35->352|1a99A|2e-44|29.6|318/341| RP:PFM:NREP 2 RP:PFM:REP 36->110|PF02030|2e-12|46.6|73/414|Lipoprotein_8| RP:PFM:REP 83->131|PF00287|8e-04|32.7|49/276|Na_K-ATPase| HM:PFM:NREP 1 HM:PFM:REP 48->289|PF01547|4.2e-17|20.2|233/314|SBP_bac_1| GO:PFM:NREP 6 GO:PFM GO:0016020|"GO:membrane"|PF02030|IPR000044| GO:PFM GO:0005391|"GO:sodium:potassium-exchanging ATPase activity"|PF00287|IPR000402| GO:PFM GO:0006754|"GO:ATP biosynthetic process"|PF00287|IPR000402| GO:PFM GO:0006813|"GO:potassium ion transport"|PF00287|IPR000402| GO:PFM GO:0006814|"GO:sodium ion transport"|PF00287|IPR000402| GO:PFM GO:0016020|"GO:membrane"|PF00287|IPR000402| RP:SCP:NREP 1 RP:SCP:REP 34->353|1potA|9e-52|38.6|319/322|c.94.1.1| HM:SCP:REP 34->353|1a99A_|1.7e-92|35.3|320/0|c.94.1.1|1/1|Periplasmic binding protein-like II| OP:NHOMO 976 OP:NHOMOORG 564 OP:PATTERN 11--------------1-11111--------------------------------------------- -11-3----------------1---3------1111----11-1------------------2-1--4221-----------1-----1111-1------------------------------1-----------44411---12112-11111--------11-12223--------------111----1-1111111111111111-111-111121111111111121111111111111111111111111111-11111111111-11111111111111111111111111111111111111111111121111--111111111111111--12211-1111111-11-------------1----1111------11121111111122222121224-1111-1123B1-21141151323523----12415552211111111111--211---------------------------------1-11111333534122323362444523834--11-----21----222-3111----433333333111-1-1-4--131--21121-------1------2-----------------------------222-313---11111121111111121131------1------22112212222222222-222222222222222222222222--12222222222222222122222221-111111111111---------11111-612111222222222223--------111-99889BC6689763344111111111-222244444233331111111----------1------11111111-1211111---1--------1-------1--111-111-2- --------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------111---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 352 STR:RPRED 98.9 SQ:SECSTR #EEccccccccHHHHccTTcccc###EEEccTcccEEEEEEETTcccTTHHHHHHHHHccEEEEEEEccHHHHHHHHHHccccccEEcccHHHHHHHHHTTccccccGGGcGGGGGccHHHHHHTTcGGGccEEEEEEEEEEEEEEHHHHHHHTTcTHHHHcHHHHGcEEEcccHHHHHHHHHHHTTccTTccHHHHHTHHHHHHHHHGGGccEEcccTHHHHHHTTcccEEEEEHHHHHHHHHHHHHHTccccTTcEEEEEEEEEccTTcccHHHHHHHHHHHHcHHHHHHHHHHHccEEccTTTGGGccHHHHTcTTTcccHHHHTTEEccccccHHHHHHHHHHHHHHHHHcc DISOP:02AL 1-2,356-357| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEccccccHHHHHHHHHHHccEEEEEEcccHHHHHHHHHHccccccEEEEccHHHHHHHHccccccccHHHcccHHHccHHHHHHccccccEEEEEEEEEEEEEEEEHHHHccccccHHHHHcHHHcccEEEEcccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHccEEEccHHHHHHHHcccEEEEEEccHHHHHHHHccccEEEEEcccccEEEEEEEEEEcccccHHHHHHHHHHHccHHHHHHHHHHHccccccccHHHHccHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHcccc //