[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : prfC
DDBJ      :prfC         peptide chain release factor 3
Swiss-Prot:RF3_STRP4    RecName: Full=Peptide chain release factor 3;         Short=RF-3;

Homologs  Archaea  57/68 : Bacteria  912/915 : Eukaryota  191/199 : Viruses  0/175   --->[See Alignment]
b.43.3c.37.1d.58.11
:514 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->512 2h5eA PDBj e-110 47.0 %
:RPS:PDB   8->505 2dy1A PDBj 2e-51 24.1 %
:RPS:SCOP  1->265 1darA2  c.37.1.8 * 6e-53 29.7 %
:RPS:SCOP  245->380 1n0uA1  b.43.3.1 * 5e-16 18.5 %
:RPS:SCOP  385->455 1fnmA4  d.58.11.1 * 1e-14 18.3 %
:HMM:SCOP  5->266 2bv3A2 c.37.1.8 * 6.2e-83 43.8 %
:HMM:SCOP  249->382 2bv3A1 b.43.3.1 * 1.1e-29 37.2 %
:HMM:SCOP  382->455 2bv3A4 d.58.11.1 * 6.4e-17 31.1 %
:RPS:PFM   11->143 PF00009 * GTP_EFTU 6e-18 35.2 %
:HMM:PFM   9->265 PF00009 * GTP_EFTU 6.9e-50 37.9 177/189  
:HMM:PFM   303->369 PF03144 * GTP_EFTU_D2 6.9e-14 29.9 67/74  
:BLT:SWISS 1->514 RF3_STRP4 0.0 100.0 %
:PROS 55->70|PS00301|EFACTOR_GTP
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56317.1 GT:GENE prfC GT:PRODUCT peptide chain release factor 3 GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 390825..392369 GB:FROM 390825 GB:TO 392369 GB:DIRECTION + GB:GENE prfC GB:PRODUCT peptide chain release factor 3 GB:NOTE identified by match to protein family HMM PF00009; match to protein family HMM PF03144; match to protein family HMM TIGR00231; match to protein family HMM TIGR00503 GB:PROTEIN_ID ACF56317.1 GB:DB_XREF GI:194357869 GB:GENE:GENE prfC LENGTH 514 SQ:AASEQ MNIQEEIKKRRTFAIISHPDAGKTTITEQLLYFGGEIREAGTVKGKKTGTFAKSDWMDIEKQRGISVTSSVMQFDYDGKRVNXLDTPGHEDFSEDTYRTLMAVDAAVMVVDSAKGIEAQTXKLFEVVKHRGIPVFTFMNKLDRDGREPLDLLQELEEILGIASYPMNWPIGMGKAFEGLYDLYNQRLELYKGDERFASLEDGDKLFGSNPFYEQVKDDIELLNEAGNEFSEEAILAGELTPVFFGSALTNFGVQTFLETFLKFAPEPHGHKKTDGEIVDPYDKDFSGFVFKIQANMDPRHRDRIAFVRIVSGEFERGMSVNLPRTGKGAKLSNVTQFMAESRENVINAVAGDIIGVYDTGTYQVGDTLTVGKNKFEFEPLPTFTPEIFMKVSAKNVMKQKSFHKGIEQLVQEGAIQLYKNYQTGEYMLGAVGQLQFEVFKHRMEGEYNAEVVMNPMGKKTVRWIKPEDLDERMSSSRNXLAKDRFDQPVFLFENDFALRWFADKYPDVELEEKM GT:EXON 1|1-514:0| SW:ID RF3_STRP4 SW:DE RecName: Full=Peptide chain release factor 3; Short=RF-3; SW:GN Name=prfC; OrderedLocusNames=SPG_0402; SW:KW Complete proteome; Cytoplasm; GTP-binding; Nucleotide-binding;Protein biosynthesis. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->514|RF3_STRP4|0.0|100.0|514/514| GO:SWS:NREP 4 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0005525|"GO:GTP binding"|GTP-binding| GO:SWS GO:0000166|"GO:nucleotide binding"|Nucleotide-binding| GO:SWS GO:0006412|"GO:translation"|Protein biosynthesis| PROS 55->70|PS00301|EFACTOR_GTP|PDOC00273| SEG 101->113|mavdaavmvvdsa| BL:PDB:NREP 1 BL:PDB:REP 5->512|2h5eA|e-110|47.0|466/488| RP:PDB:NREP 1 RP:PDB:REP 8->505|2dy1A|2e-51|24.1|477/660| RP:PFM:NREP 1 RP:PFM:REP 11->143|PF00009|6e-18|35.2|128/183|GTP_EFTU| HM:PFM:NREP 2 HM:PFM:REP 9->265|PF00009|6.9e-50|37.9|177/189|GTP_EFTU| HM:PFM:REP 303->369|PF03144|6.9e-14|29.9|67/74|GTP_EFTU_D2| GO:PFM:NREP 2 GO:PFM GO:0003924|"GO:GTPase activity"|PF00009|IPR000795| GO:PFM GO:0005525|"GO:GTP binding"|PF00009|IPR000795| RP:SCP:NREP 3 RP:SCP:REP 1->265|1darA2|6e-53|29.7|229/254|c.37.1.8| RP:SCP:REP 245->380|1n0uA1|5e-16|18.5|124/138|b.43.3.1| RP:SCP:REP 385->455|1fnmA4|1e-14|18.3|71/79|d.58.11.1| HM:SCP:REP 5->266|2bv3A2|6.2e-83|43.8|256/0|c.37.1.8|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 249->382|2bv3A1|1.1e-29|37.2|121/0|b.43.3.1|1/1|Translation proteins| HM:SCP:REP 382->455|2bv3A4|6.4e-17|31.1|74/0|d.58.11.1|1/1|EF-G C-terminal domain-like| OP:NHOMO 4613 OP:NHOMOORG 1160 OP:PATTERN 1111111111111111111111111-111111--111------11111-11112111111111-1111 4443733333233332234-4333334444424333334433334422444224332422335332455342444343444422333365552555312545444634542222222222222245544454454544433444435565665344444444466455556444444444444555333334334444444434444445333334443335444444444564644444444445434444445544445545665544454444545544444444444455545545433444444543446544474544556666666666566555666665644556536645343434444334453544455444444565554555554444444444414444454455435554454555444444444454654444444444444444565333333332322333333333333333333445455554544454444344445644444444566653455555444555555445454444444444444455556666666566666456656666677776666433333343333333333333333344444545545556555555655556455565214544444244444444544444444444-44444444444444444445554544444444444443444445444443342544444444444224444444444454645433444444434444444444444445555554444555544444444444444555655555565665544444444444444535556553223333343422223-23322222222322222223333333333253 67--443-C43-4532232333333333333333333333333333213333333332333333344423343334522543333333-32323432222222332-4A455633482333233883719I5-457322251342332-132262523648C25232334I33635666*76454A58D1887697546 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 512 STR:RPRED 99.6 SQ:SECSTR TTccccGccEEEEEEEEcTTccHHHHHHHHHHHTTcccccccGGGTccccHHHHcccHHHHHTTcccccEEEEEEETTEEEEEEEccccGGGHHHHHHHHHHccEEEEEEETTTcccHHHHHHHHHHHHTTccEEEEEEcGGGcccHHHHHHHHHHHHccEEEEEcEEEEEETTEEEEEEETTTTEEEEETTEEEEEcccGGGHHHHHHHHHHHHTTcHHHHHHHHHHHHHHHHHTTccEEEEEccTTTTccHHHHHHHHHHHcccHHHHcccTccEEEHcccccEEEEEEEEEETccTTTEEEEEEEEEEcEEcTTEEEccTTccEEEEEccEEEEETTEEEEEccEETTcEEEEcccTTccTTcEEEccccGGGccccccccccEEEEEEEccHHHHHHHHHHHHHHHHHcTTcEEEcTTTccEEEEEccHHHHHHTHHHHHHHTTccEEEEccccccEEEEcccEEEEEEEEEEEEEEEEEEEccccEEEEcccTTcccGGGHHHEEEc## DISOP:02AL 1-7| PSIPRED cccHHHHcccEEEEEEccccccHHHHHHHHHHHHcHHHHccEEcccccccEEccccHHHHHHHcccEEEEEEEEEEccEEEEEEcccccccHHHHHHHHHHHHcEEEEEEEccccccccHHHHHHHHHHccccEEEEEEccccccccHHHHHHHHHHHHccccEEEEcccEEccccEEEEEEEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccccccHHHHHHHHHHHccccccccccccccccccccccccEEEEEEEccccccccEEEEEEEEEEEEccccEEEEEccccEEEEEEEEEEccccEEEEEEEccccEEEEEcccccEEccEEEccccccccccccccccEEEEEEEEccHHHHHHHHHHHHHHHHcccEEEEEccccccEEEEEccHHHHHHHHHHHHHHHccEEEEEcccEEEEEEEEHHHccccccccccEEEEEccccEEEEEccHHHHHHHHHHccccEEEEcc //