[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : pspA
DDBJ      :pspA         pneumococcal surface protein A
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  42/915 : Eukaryota  6/199 : Viruses  4/175   --->[See Alignment]
b.109.1
:709 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   474->709 2vyuA PDBj 4e-60 48.3 %
:RPS:PDB   202->254 1bg1A PDBj 2e-05 20.8 %
:RPS:PDB   472->709 1b9sA PDBj 1e-36 12.0 %
:RPS:SCOP  472->698 2bibA1  b.109.1.1 * 1e-70 41.1 %
:HMM:SCOP  463->591 1h09A1 b.109.1.1 * 3.4e-49 59.7 %
:HMM:SCOP  592->709 2bibA1 b.109.1.1 * 4.4e-44 52.1 %
:RPS:PFM   87->160 PF03097 * BRO1 3e-04 31.1 %
:RPS:PFM   204->241,329->380 PF05667 * DUF812 2e-04 37.3 %
:HMM:PFM   472->490 PF01473 * CW_binding_1 6.9e-06 52.6 19/19  
:HMM:PFM   492->510 PF01473 * CW_binding_1 3.3e-09 57.9 19/19  
:HMM:PFM   512->530 PF01473 * CW_binding_1 2.4e-09 52.6 19/19  
:HMM:PFM   532->550 PF01473 * CW_binding_1 1.1e-09 57.9 19/19  
:HMM:PFM   552->570 PF01473 * CW_binding_1 5.8e-09 47.4 19/19  
:HMM:PFM   572->590 PF01473 * CW_binding_1 2.4e-09 52.6 19/19  
:HMM:PFM   592->610 PF01473 * CW_binding_1 1.1e-09 57.9 19/19  
:HMM:PFM   612->630 PF01473 * CW_binding_1 2.4e-09 52.6 19/19  
:HMM:PFM   632->650 PF01473 * CW_binding_1 1.6e-09 57.9 19/19  
:HMM:PFM   652->670 PF01473 * CW_binding_1 2.4e-09 57.9 19/19  
:HMM:PFM   674->690 PF01473 * CW_binding_1 6.5e-05 35.3 17/19  
:HMM:PFM   194->249 PF04582 * Reo_sigmaC 1.5e-05 25.0 56/326  
:HMM:PFM   282->350 PF12329 * TMF_DNA_bd 2.6e-06 32.8 67/74  
:HMM:PFM   318->387 PF01017 * STAT_alpha 0.00012 26.5 68/182  
:HMM:PFM   114->218 PF07926 * TPR_MLP1_2 0.00023 17.1 105/132  
:BLT:SWISS 474->709 LYTB_STRR6 1e-37 38.6 %
:PROS 533->544|PS00213|LIPOCALIN
:PROS 593->604|PS00213|LIPOCALIN
:PROS 633->644|PS00213|LIPOCALIN
:COIL
:REPEAT 11|470->489|490->509|510->529|530->549|550->569|570->589|590->609|610->629|630->649|650->669|670->690
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF54852.1 GT:GENE pspA GT:PRODUCT pneumococcal surface protein A GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 123363..125492 GB:FROM 123363 GB:TO 125492 GB:DIRECTION + GB:GENE pspA GB:PRODUCT pneumococcal surface protein A GB:NOTE identified by match to protein family HMM PF01473 GB:PROTEIN_ID ACF54852.1 GB:DB_XREF GI:194356404 GB:GENE:GENE pspA LENGTH 709 SQ:AASEQ MNKKKMILTSLASVAILGAGFVASQPTVVRAEAAPQVVEKSSLEKKYEEAKAKADTAKKDYETAKKKAAEAQKKYEDDQKRTEEKGALEEETSRKVNDATLEVQNAYVEYGEANKKKGKDREKKLADAQKKIDEAQEKLTKAKNEFQSVRAMVVPEPEQLAETKKKAEEAKAEEAVAKEKSDKAAKEVEVAKKRVEAEEAELDKKVAELQNKVADLEKEIADAEKTVADLEKEVAKLEKDVEDFKNSNGEQAEQYLAAAEKDLVAKKAELAEAKIKAATKKAELEPELEKAEAELENLLSTLDPEGKTQDELDKEAAEAELNKKVEALQNQVAELEEELSKLEDNLKDAETNNVEDYIKEGLEEAIATKKAELEKTQKELDAALNELGPDGDEEETPAPAPQPEKPAPAPAPKPEQPAPAPKPEKTDDQQAEEDYARRSEEEYNRLPQQQPPKAEKPAPAPKPEQPVPAPKTGWKQENGMWYFYNTDGSMATGWLQNNGSWYYLNSNGAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGAMATGWLQYNDSWYYLNANGAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGAMATGWLQYNGSWYYLNANGAMATGWAKVNGSWYYLNANGSMATGWVKDGDTWYYLEASGAMKASQWFKVSDKWYYVNGLGALAVNTTVDGYKVNANGEWV GT:EXON 1|1-709:0| BL:SWS:NREP 1 BL:SWS:REP 474->709|LYTB_STRR6|1e-37|38.6|236/702| PROS 533->544|PS00213|LIPOCALIN|PDOC00187| PROS 593->604|PS00213|LIPOCALIN|PDOC00187| PROS 633->644|PS00213|LIPOCALIN|PDOC00187| COIL:NAA 299 COIL:NSEG 4 COIL:REGION 39->85| COIL:REGION 112->154| COIL:REGION 158->285| COIL:REGION 308->388| NREPEAT 1 REPEAT 11|470->489|490->509|510->529|530->549|550->569|570->589|590->609|610->629|630->649|650->669|670->690| SEG 44->78|ekkyeeakakadtakkdyetakkkaaeaqkkyedd| SEG 161->201|aetkkkaeeakaeeavakeksdkaakevevakkrveaeeae| SEG 256->299|laaaekdlvakkaelaeakikaatkkaelepelekaeaelenll| SEG 311->328|eldkeaaeaelnkkveal| SEG 393->426|eeetpapapqpekpapapapkpeqpapapkpekt| SEG 447->471|pqqqppkaekpapapkpeqpvpapk| BL:PDB:NREP 1 BL:PDB:REP 474->709|2vyuA|4e-60|48.3|236/300| RP:PDB:NREP 2 RP:PDB:REP 202->254|1bg1A|2e-05|20.8|53/558| RP:PDB:REP 472->709|1b9sA|1e-36|12.0|225/390| RP:PFM:NREP 2 RP:PFM:REP 87->160|PF03097|3e-04|31.1|74/323|BRO1| RP:PFM:REP 204->241,329->380|PF05667|2e-04|37.3|89/491|DUF812| HM:PFM:NREP 15 HM:PFM:REP 472->490|PF01473|6.9e-06|52.6|19/19|CW_binding_1| HM:PFM:REP 492->510|PF01473|3.3e-09|57.9|19/19|CW_binding_1| HM:PFM:REP 512->530|PF01473|2.4e-09|52.6|19/19|CW_binding_1| HM:PFM:REP 532->550|PF01473|1.1e-09|57.9|19/19|CW_binding_1| HM:PFM:REP 552->570|PF01473|5.8e-09|47.4|19/19|CW_binding_1| HM:PFM:REP 572->590|PF01473|2.4e-09|52.6|19/19|CW_binding_1| HM:PFM:REP 592->610|PF01473|1.1e-09|57.9|19/19|CW_binding_1| HM:PFM:REP 612->630|PF01473|2.4e-09|52.6|19/19|CW_binding_1| HM:PFM:REP 632->650|PF01473|1.6e-09|57.9|19/19|CW_binding_1| HM:PFM:REP 652->670|PF01473|2.4e-09|57.9|19/19|CW_binding_1| HM:PFM:REP 674->690|PF01473|6.5e-05|35.3|17/19|CW_binding_1| HM:PFM:REP 194->249|PF04582|1.5e-05|25.0|56/326|Reo_sigmaC| HM:PFM:REP 282->350|PF12329|2.6e-06|32.8|67/74|TMF_DNA_bd| HM:PFM:REP 318->387|PF01017|0.00012|26.5|68/182|STAT_alpha| HM:PFM:REP 114->218|PF07926|0.00023|17.1|105/132|TPR_MLP1_2| RP:SCP:NREP 1 RP:SCP:REP 472->698|2bibA1|1e-70|41.1|224/232|b.109.1.1| HM:SCP:REP 463->591|1h09A1|3.4e-49|59.7|129/0|b.109.1.1|1/2|Cell wall binding repeat| HM:SCP:REP 592->709|2bibA1|4.4e-44|52.1|117/0|b.109.1.1|2/2|Cell wall binding repeat| OP:NHOMO 393 OP:NHOMOORG 52 OP:PATTERN -------------------------------------------------------------------- ------------------------------------------------------------------------------36-M-----------------------------------------------------------------------------------------------------------------------1--11-----------1------1----------------------------1------1-----88---5-5612---------455ECCFEEECDGA-------------1------------1q-------X-Z-3---674---2---2--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------1-------1-----------------------------------------------3----12--------2------------------------- ---------------1---------------------------------------------------------1---------------------------------------------------1-1----------------------------------------------- STR:NPRED 291 STR:RPRED 41.0 SQ:SECSTR #########################################################################################################################################################################################################HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTcccccTTHHHHHHH#########################################################################################################################################################################################################################ccccccTTccccccEEEEEETTccccTTcEEEEEcccEEEEEcEEEcccEEEEEEEccGGGcEEEEEETTEEEEEEccccccEEcccccEEETTEEEEEEEccccccccEEEEEEETTEEEEEEccEEccccccccEccccEEEEETTEEEEEcTTcEccccccccccEEEEEETTTTEEEEEEccccccccEcccccTTcccccTTcccccccccccccEEEEEccccEEEEEEEcc DISOP:02AL 1-4,20-459,464-464| PSIPRED ccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccEEEEcccEEEEcccccccccEEEEcccEEEEcccccEEEEEEEEccEEEEEcccccEEEEEEEEcccEEEEcccccEEEEEEEEcccEEEEcccccEEEEEEEEccEEEEEcccccEEEcEEEEccEEEEEcccccEEEEEEEEccEEEEEcccccEEEEEEEEccEEEEEcccccEEccEEEEEccEEEEEcccccEEEEEEEEEEEEccccccc //