[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : ptsH
DDBJ      :ptsH         phosphocarrier protein HPr
Swiss-Prot:PTHP_STRSL   RecName: Full=Phosphocarrier protein HPr;         EC=2.7.11.-;AltName: Full=Histidine-containing protein;

Homologs  Archaea  0/68 : Bacteria  374/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.94.1
:87 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->87 1qfrA PDBj 4e-32 73.6 %
:RPS:PDB   4->84 1cm3A PDBj 1e-15 33.3 %
:RPS:SCOP  1->84 1cm2A  d.94.1.1 * 1e-15 34.5 %
:HMM:SCOP  1->85 1opdA_ d.94.1.1 * 6.6e-26 49.4 %
:RPS:PFM   3->84 PF00381 * PTS-HPr 2e-13 54.9 %
:HMM:PFM   1->83 PF00381 * PTS-HPr 5.1e-34 56.6 83/84  
:BLT:SWISS 1->87 PTHP_STRSL 2e-35 94.3 %
:PROS 13->20|PS00369|PTS_HPR_HIS
:PROS 39->54|PS00589|PTS_HPR_SER
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56711.1 GT:GENE ptsH GT:PRODUCT phosphocarrier protein HPr GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1053922..1054185) GB:FROM 1053922 GB:TO 1054185 GB:DIRECTION - GB:GENE ptsH GB:PRODUCT phosphocarrier protein HPr GB:NOTE identified by match to protein family HMM PF00381; match to protein family HMM TIGR01003 GB:PROTEIN_ID ACF56711.1 GB:DB_XREF GI:194358263 GB:GENE:GENE ptsH LENGTH 87 SQ:AASEQ MASKDFHVVAETGIHARPATLLVQTASKFASDITLEYKGKSVNLKSIMGVMSLGVGQGADVTISAEGADAXDAIAAISETMEKEGLA GT:EXON 1|1-87:0| SW:ID PTHP_STRSL SW:DE RecName: Full=Phosphocarrier protein HPr; EC=2.7.11.-;AltName: Full=Histidine-containing protein; SW:GN Name=ptsH; SW:KW Cytoplasm; Direct protein sequencing; Kinase; Phosphoprotein;Phosphotransferase system; Sugar transport; Transcription;Transcription regulation; Transferase; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->87|PTHP_STRSL|2e-35|94.3|87/87| GO:SWS:NREP 8 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| GO:SWS GO:0016301|"GO:kinase activity"|Kinase| GO:SWS GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|Phosphotransferase system| GO:SWS GO:0008643|"GO:carbohydrate transport"|Sugar transport| GO:SWS GO:0006350|"GO:transcription"|Transcription| GO:SWS GO:0045449|"GO:regulation of transcription"|Transcription regulation| GO:SWS GO:0016740|"GO:transferase activity"|Transferase| GO:SWS GO:0006810|"GO:transport"|Transport| PROS 13->20|PS00369|PTS_HPR_HIS|PDOC00318| PROS 39->54|PS00589|PTS_HPR_SER|PDOC00318| SEG 68->77|adaxdaiaai| BL:PDB:NREP 1 BL:PDB:REP 1->87|1qfrA|4e-32|73.6|87/89| RP:PDB:NREP 1 RP:PDB:REP 4->84|1cm3A|1e-15|33.3|81/84| RP:PFM:NREP 1 RP:PFM:REP 3->84|PF00381|2e-13|54.9|82/83|PTS-HPr| HM:PFM:NREP 1 HM:PFM:REP 1->83|PF00381|5.1e-34|56.6|83/84|PTS-HPr| GO:PFM:NREP 2 GO:PFM GO:0005351|"GO:sugar:hydrogen symporter activity"|PF00381|IPR005698| GO:PFM GO:0009401|"GO:phosphoenolpyruvate-dependent sugar phosphotransferase system"|PF00381|IPR005698| RP:SCP:NREP 1 RP:SCP:REP 1->84|1cm2A|1e-15|34.5|84/85|d.94.1.1| HM:SCP:REP 1->85|1opdA_|6.6e-26|49.4|85/85|d.94.1.1|1/1|HPr-like| OP:NHOMO 418 OP:NHOMOORG 375 OP:PATTERN -------------------------------------------------------------------- ----1--------------------------------------------11--1----------------------111-----------------------------1---------------11-------1--1-----------------------------------------------1---1-1122222222222222222222222222222321111111141111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1-111111111111-11111112-121-2------1--2--111121--1-11-------------------1---------------------------------------------------------------1----------------------------------------11111111111111111--11111111-111---111------------1-1111------------11----------------11111111111-11------------------------------11--------------11-----1------1-------1-111111111-1111111-11-1111111111112111112---111111111111111111111111111111--111111111111--------------------1-1-11111111---------------------------------------1111111111111111111111111111-------------------12----1---1-1------1--11111-----1----1-1 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 87 STR:RPRED 100.0 SQ:SECSTR cEEEEEEEcccccccHHHHHHHHHHHHTcccEEEEEETTEEEETTcHHHHTTccccTTcEEEEEEEcTTHHHHHHHHHHHHHHcccc DISOP:02AL 1-1| PSIPRED ccEEEEEEEccccccHHHHHHHHHHHHccccEEEEEEccEEEEHHHHHHHHHHccccccEEEEEEEcccHHHHHHHHHHHHHHcccc //