[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : pyrDII
DDBJ      :pyrDII       dihydroorotate dehydrogenase electron transfer subunit
Swiss-Prot:PYRK_STRR6   RecName: Full=Dihydroorotate dehydrogenase electron transfer subunit;

Homologs  Archaea  30/68 : Bacteria  207/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.43.4c.25.1
:266 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   15->259 1ep1B PDBj 2e-59 51.4 %
:RPS:PDB   15->232 2bgjA PDBj 2e-23 10.6 %
:RPS:SCOP  13->106 1a8pA1  b.43.4.2 * 5e-18 22.3 %
:RPS:SCOP  135->266 1ep1B2  c.25.1.3 * 4e-22 46.2 %
:HMM:SCOP  11->108 1ep3B1 b.43.4.2 * 7.4e-24 40.8 %
:HMM:SCOP  103->266 1ep3B2 c.25.1.3 * 2.7e-40 37.3 %
:RPS:PFM   16->106 PF00970 * FAD_binding_6 2e-08 36.3 %
:RPS:PFM   225->265 PF10418 * DHODB_Fe-S_bind 7e-08 63.2 %
:HMM:PFM   121->211 PF00175 * NAD_binding_1 1.1e-19 38.5 91/109  
:HMM:PFM   225->264 PF10418 * DHODB_Fe-S_bind 2e-18 56.4 39/40  
:HMM:PFM   17->106 PF00970 * FAD_binding_6 5.9e-12 31.1 90/99  
:BLT:SWISS 11->266 PYRK_STRR6 e-133 98.8 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55142.1 GT:GENE pyrDII GT:PRODUCT dihydroorotate dehydrogenase electron transfer subunit GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 855358..856158 GB:FROM 855358 GB:TO 856158 GB:DIRECTION + GB:GENE pyrDII GB:PRODUCT dihydroorotate dehydrogenase electron transfer subunit GB:NOTE identified by match to protein family HMM PF00175; match to protein family HMM PF00970 GB:PROTEIN_ID ACF55142.1 GB:DB_XREF GI:194356694 GB:GENE:GENE pyrDII LENGTH 266 SQ:AASEQ MNLTCKKRLGVIRLETMKVVAQEEIAPAIFELVLEGEMVEAMRAGQFLHLRVPXDAHLLRRPISISSIDKANKQCHLIYRIEGAGTAIFSTLSQGDTLDVMGPQGNGFDLSDLDEQNQVLLVGGGIGVPPLLEVAKELHERGVKVVTVLGFANKDAVILKTELAQYGQVFVTTDDGSYGIKGNVSVVINDLDSQFDAVYXCGAPGMMKYINQTFDDHPRAYLSLESRMACGMGACYACVLKVPESETVSQRVCEDGPVFRTGTVVL GT:EXON 1|1-266:0| SW:ID PYRK_STRR6 SW:DE RecName: Full=Dihydroorotate dehydrogenase electron transfer subunit; SW:GN Name=pyrK; Synonyms=pyrDII; OrderedLocusNames=spr0865; SW:KW 2Fe-2S; Complete proteome; Electron transport; FAD; Flavoprotein;Iron; Iron-sulfur; Metal-binding; Pyrimidine biosynthesis; Transport. SW:EXACT F SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 11->266|PYRK_STRR6|e-133|98.8|256/256| GO:SWS:NREP 6 GO:SWS GO:0051537|"GO:2 iron, 2 sulfur cluster binding"|2Fe-2S| GO:SWS GO:0022900|"GO:electron transport chain"|Electron transport| GO:SWS GO:0051536|"GO:iron-sulfur cluster binding"|Iron-sulfur| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| GO:SWS GO:0006221|"GO:pyrimidine nucleotide biosynthetic process"|Pyrimidine biosynthesis| GO:SWS GO:0006810|"GO:transport"|Transport| SEG 119->134|vllvgggigvppllev| BL:PDB:NREP 1 BL:PDB:REP 15->259|1ep1B|2e-59|51.4|245/261| RP:PDB:NREP 1 RP:PDB:REP 15->232|2bgjA|2e-23|10.6|218/260| RP:PFM:NREP 2 RP:PFM:REP 16->106|PF00970|2e-08|36.3|91/99|FAD_binding_6| RP:PFM:REP 225->265|PF10418|7e-08|63.2|38/38|DHODB_Fe-S_bind| HM:PFM:NREP 3 HM:PFM:REP 121->211|PF00175|1.1e-19|38.5|91/109|NAD_binding_1| HM:PFM:REP 225->264|PF10418|2e-18|56.4|39/40|DHODB_Fe-S_bind| HM:PFM:REP 17->106|PF00970|5.9e-12|31.1|90/99|FAD_binding_6| GO:PFM:NREP 2 GO:PFM GO:0016491|"GO:oxidoreductase activity"|PF00970|IPR008333| GO:PFM GO:0055114|"GO:oxidation reduction"|PF00970|IPR008333| RP:SCP:NREP 2 RP:SCP:REP 13->106|1a8pA1|5e-18|22.3|94/99|b.43.4.2| RP:SCP:REP 135->266|1ep1B2|4e-22|46.2|132/160|c.25.1.3| HM:SCP:REP 11->108|1ep3B1|7.4e-24|40.8|98/0|b.43.4.2|1/1|Riboflavin synthase domain-like| HM:SCP:REP 103->266|1ep3B2|2.7e-40|37.3|158/0|c.25.1.3|1/1|Ferredoxin reductase-like, C-terminal NADP-linked domain| OP:NHOMO 359 OP:NHOMOORG 237 OP:PATTERN ----------------1------1--------1-11111111--22122222212211121--11--- ----------------------------------------1----------------------1------111111112121-1111122222222-----------------------------21221-23321-----222-----1--------------------------------------222-111111111111111111111111111111111111111--1--------------1----2----------------1-----111-------11111111111111-------------111111111-2111433333334352211222224221-22222224212112333111--11-----------------22-1---------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------2122112-11111-313123432------2----------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------11-2--------------11-------------------1------2121111111--- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 259 STR:RPRED 97.4 SQ:SECSTR cccccccccccccETEEEEEEEEEEETTEEEEEEEccTTccccTTcEEEEEEETTccEEEEEEEccccTTccEEEEEEEccTTcTTHHHTTccTTcEEEEEEEEEccccGGGcccccEEEEEEEGGGGHHHHHHTTcHHHHHcEEEEEEEEccTTTTHHHHHHHHHHEEEEEEccccccccccHHHTcccccTTTEEEEEEEcHHHHHHHHHHHHHcccccEEEEEccccccccccTTEEEcccTTccEEETTTTccEE####### DISOP:02AL 1-1,3-3,6-6| PSIPRED cEEEcccccccEEEEEEEEEEEEEccccEEEEEEccccccccccccEEEEEEEccccEEEEEEEEccccccccEEEEEEEEcccHHHHHHHcccccEEEEEccccccccccccccccEEEEEEccccHHHHHHHHHHHHHcccEEEEEEEEccHHHHHcHHHHHHHccEEEEcccccccccccHHHHHHHccccccEEEEEccHHHHHHHHHHHHHcccEEEEEEcccccccccccEEEEEccccccEEEEEcccccEEEHHHccc //