[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : radA
DDBJ      :radA         DNA repair protein RadA
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  837/915 : Eukaryota  21/199 : Viruses  0/175   --->[See Alignment]
a.243.1c.37.1d.14.1
:420 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   269->418 1z0wA PDBj 1e-09 28.1 %
:RPS:PDB   83->247 3dvlC PDBj 2e-28 19.1 %
:RPS:SCOP  118->229 1xkpA1  a.243.1.3 * 2e-23 14.2 %
:RPS:SCOP  249->419 1xhkA  d.14.1.10 * 7e-33 21.9 %
:HMM:SCOP  5->237 1ubeA1 c.37.1.11 * 3.3e-52 38.1 %
:HMM:SCOP  218->422 1xhkA_ d.14.1.10 * 3.1e-43 37.2 %
:RPS:PFM   39->227 PF06745 * KaiC 1e-27 48.9 %
:RPS:PFM   273->416 PF05362 * Lon_C 5e-10 32.6 %
:HMM:PFM   38->242 PF06745 * KaiC 5.3e-14 26.4 197/226  
:HMM:PFM   323->418 PF05362 * Lon_C 2.8e-08 25.0 96/205  
:BLT:SWISS 11->420 RADA_STRP8 0.0 79.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55916.1 GT:GENE radA GT:PRODUCT DNA repair protein RadA GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 25150..26412 GB:FROM 25150 GB:TO 26412 GB:DIRECTION + GB:GENE radA GB:PRODUCT DNA repair protein RadA GB:NOTE identified by match to protein family HMM TIGR00416 GB:PROTEIN_ID ACF55916.1 GB:DB_XREF GI:194357468 GB:GENE:GENE radA LENGTH 420 SQ:AASEQ MEEVEVAEVKNARVSLTGEKTKPMKLAEVTSINVNRTKTEMEEFNRVLGGGVVPGSLVLIGGDPGIGKSTLLLQVSTQLSQVGTVLYVSGEESAQQIKLRAERLGDIDSEFYLYAETNMQSVRAEVERIQPDFLIIDSIQTIMSPEISGVQGSVSQVREVTAELMQLAKTNNIAIFIVGHVTKEGTLAGPRMLEHMVDTVLYFEGERHHTFRILRAVKNRFGSTNEIGIFEMQSGGLVEVLNPSQVFLEERLDGATGSSIVVTMEGTRPILAEVQALVTPTMFGNAKRTTTGLDFNRASLIMAVLEKRAGLLLQNQDAYLKSAGGVKLDEPAIDLAVAVAIASSYKDKPTNPQECFVGELGLTGEIRRVNRIEQRINEAAKLGFTKIYVPKNSLTGITLPKEIQVIGVTTIQEVLKKVFA GT:EXON 1|1-420:0| BL:SWS:NREP 1 BL:SWS:REP 11->420|RADA_STRP8|0.0|79.3|410/453| SEG 47->62|vlgggvvpgslvligg| SEG 69->82|stlllqvstqlsqv| BL:PDB:NREP 1 BL:PDB:REP 269->418|1z0wA|1e-09|28.1|146/203| RP:PDB:NREP 1 RP:PDB:REP 83->247|3dvlC|2e-28|19.1|157/486| RP:PFM:NREP 2 RP:PFM:REP 39->227|PF06745|1e-27|48.9|182/202|KaiC| RP:PFM:REP 273->416|PF05362|5e-10|32.6|141/186|Lon_C| HM:PFM:NREP 2 HM:PFM:REP 38->242|PF06745|5.3e-14|26.4|197/226|KaiC| HM:PFM:REP 323->418|PF05362|2.8e-08|25.0|96/205|Lon_C| GO:PFM:NREP 3 GO:PFM GO:0004176|"GO:ATP-dependent peptidase activity"|PF05362|IPR008269| GO:PFM GO:0004252|"GO:serine-type endopeptidase activity"|PF05362|IPR008269| GO:PFM GO:0006508|"GO:proteolysis"|PF05362|IPR008269| RP:SCP:NREP 2 RP:SCP:REP 118->229|1xkpA1|2e-23|14.2|106/197|a.243.1.3| RP:SCP:REP 249->419|1xhkA|7e-33|21.9|169/185|d.14.1.10| HM:SCP:REP 5->237|1ubeA1|3.3e-52|38.1|231/0|c.37.1.11|1/1|P-loop containing nucleoside triphosphate hydrolases| HM:SCP:REP 218->422|1xhkA_|3.1e-43|37.2|172/0|d.14.1.10|1/1|Ribosomal protein S5 domain 2-like| OP:NHOMO 901 OP:NHOMOORG 858 OP:PATTERN -------------------------------------------------------------------- ----11111111-111111-11--1111111-11111111111111-11111111111--111111111111111111----111111111111111--11111111111111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-1111111111111111111111111111111111212211122222221122122212211111113322222111111111111-111111111111111111111111111111111-111111111111111111111111111111111111111111111111111111111-11111--1111111111111111-11-111111111111111111111111111111111111111121111111111211111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111111111111111111111111111111111111111111-111111111111--11111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111--11111111-----1-111--------------------------1111111111--- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-1-7111111122-16112111- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2,4-33,144-157,245-253,287-287| PSIPRED ccEEEEccccccccccccccccEEEcccccEEcccccccccHHHHHHHcccccccEEEEEEccccccHHHHHHHHHHHHHHccEEEEEEccccHHHHHHHHHHccccccccEEcccHHHHHHHHHHHHccccEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHcccEEEEEEEEEEccccccccEEEEEEEEEEEEEccccccEEEEEEEcccccccccEEEEEEcccccccccccHHHHHHccccccccEEEEEEEEccccEEEEEEEEEEccccccEEEEEEcHHHHHHHHHHHHHHHHHccccccccEEEEEccccccccccccHHHHHHHHHHHHcccccccEEEEEEcccccEEEEEccHHHHHHHHHHccccEEEEcHHHHHccccccccEEEEEccHHHHHHHHcc //