[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : radC
DDBJ      :radC         DNA repair protein RadC
Swiss-Prot:RADC_STRZT   RecName: Full=DNA repair protein radC homolog;

Homologs  Archaea  9/68 : Bacteria  672/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.60.12a.60.2
:226 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   114->221 2qlcE PDBj 3e-21 42.6 %
:RPS:PDB   6->93 3c1yA PDBj 1e-05 15.9 %
:RPS:SCOP  41->119 2axtU1  a.60.12.2 * 5e-04 10.8 %
:HMM:SCOP  15->94 2a1jB1 a.60.2.5 * 3.1e-07 30.8 %
:RPS:PFM   104->222 PF04002 * DUF2466 2e-20 38.7 %
:HMM:PFM   104->223 PF04002 * DUF2466 8.8e-45 44.2 120/123  
:HMM:PFM   24->77 PF02831 * gpW 7.2e-05 34.0 53/68  
:BLT:SWISS 1->226 RADC_STRZT e-114 100.0 %
:PROS 174->179|PS01302|UPF0758
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55614.1 GT:GENE radC GT:PRODUCT DNA repair protein RadC GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 971498..972178 GB:FROM 971498 GB:TO 972178 GB:DIRECTION + GB:GENE radC GB:PRODUCT DNA repair protein RadC GB:NOTE identified by match to protein family HMM PF04002; match to protein family HMM TIGR00608 GB:PROTEIN_ID ACF55614.1 GB:DB_XREF GI:194357166 GB:GENE:GENE radC LENGTH 226 SQ:AASEQ MYSISFQEDSLLPRERLAKEGVEALSNQELLAILLRTGTRQASVFEIAQKVLNNLSSLTDLKKMTLQELQSLSGIGRVKAIELQAMIELGHRIHKHETLEMESILSSQKLAKKMQQELGDKKQEHLVALYLNTQNQIIHQQTIFIGSVTRSIAEPREILHYAIKHMATSLILVHNHPSGAVAPSQNDDHVTKLVKEACELMGIVLLDHLIVSHSNYFSYREKTDLI GT:EXON 1|1-226:0| SW:ID RADC_STRZT SW:DE RecName: Full=DNA repair protein radC homolog; SW:GN Name=radC; OrderedLocusNames=SPT_1135; SW:KW Complete proteome; DNA damage; DNA repair. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->226|RADC_STRZT|e-114|100.0|226/226| GO:SWS:NREP 2 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| PROS 174->179|PS01302|UPF0758|PDOC01006| SEG 132->145|ntqnqiihqqtifi| BL:PDB:NREP 1 BL:PDB:REP 114->221|2qlcE|3e-21|42.6|108/124| RP:PDB:NREP 1 RP:PDB:REP 6->93|3c1yA|1e-05|15.9|82/349| RP:PFM:NREP 1 RP:PFM:REP 104->222|PF04002|2e-20|38.7|119/123|DUF2466| HM:PFM:NREP 2 HM:PFM:REP 104->223|PF04002|8.8e-45|44.2|120/123|DUF2466| HM:PFM:REP 24->77|PF02831|7.2e-05|34.0|53/68|gpW| RP:SCP:NREP 1 RP:SCP:REP 41->119|2axtU1|5e-04|10.8|74/98|a.60.12.2| HM:SCP:REP 15->94|2a1jB1|3.1e-07|30.8|78/0|a.60.2.5|1/1|RuvA domain 2-like| OP:NHOMO 824 OP:NHOMOORG 682 OP:PATTERN -------------------------------------------11111-1111--------------- ----------------------------------------------------------------------------------11-1111222-1111--11411112112--------------1111221111-2111112221111111111111------11111111-----------------1112-11111111211111111111111112123111111111112111-1111111111111111111111111111111111111-11111111111111111111111111111111111111211111111112111111111111111112112121211111112222111111131111223-1111111111111111111111111111111-111111-11-1--111111111111-1-112211211111111111121111-1111111111-111--11-11---11-3-43-1111111113111111111112211111111111111--11121112312111132111111111111111212211132111111111111-32-2125111-1111-----------------------1111232111211111111211121121111111--12113------11231113111311111-12322111111111131111212222221211111111111112111111---111121111232--11-1-111111-151111111-2211-111111111-11112112111122212211111---------11311222322121411211111111111--11--1111--------1-1-------------------------1-11111111-11 --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 195 STR:RPRED 86.3 SQ:SECSTR #####HHTTcccccGGGGGGcccccccHHHHHHTccccHHTccHH#HHHHHHHHHccHHHHTTccHHHHTTcTTccHHHHHHHHHHHHHHHHH####################HTTccccTTccEEEEEEEcTTccEEEEEEEEcccccGGGccHHHHHHHHHHTTccEEEEEEEcTTccccccHHHHHHHHHHHHHHHHHTcEEEEEEEEccccEEETTT##### DISOP:02AL 7-7,180-182| PSIPRED cccHHHccccccHHHHHHHccHHHccHHHHHHHHHHcccccccHHHHHHHHHHHcccHHHHHcccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccEEEEEEEcccccEEEEEEEEEcccccEEEcHHHHHHHHHHHcccEEEEEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEccccEEEHHHccccc //