[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : recO
DDBJ      :recO         DNA repair protein RecO
Swiss-Prot:RECO_STRP4   RecName: Full=DNA repair protein recO;AltName: Full=Recombination protein O;

Homologs  Archaea  0/68 : Bacteria  143/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
b.40.4g.45.1
:256 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  3->70 1u5kA1  b.40.4.13 * 1e-16 16.4 %
:RPS:SCOP  102->244 1u5kA2  g.45.1.2 * 2e-17 12.7 %
:HMM:SCOP  1->79 1u5kA1 b.40.4.13 * 3.6e-15 32.1 %
:HMM:SCOP  81->234 1u5kA2 g.45.1.2 * 4.7e-42 33.3 %
:HMM:PFM   84->238 PF02565 * RecO_C 1.4e-24 29.6 115/118  
:HMM:PFM   4->72 PF11967 * RecO_N 9.3e-18 29.0 69/80  
:BLT:SWISS 1->256 RECO_STRP4 e-142 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF55812.1 GT:GENE recO GT:PRODUCT DNA repair protein RecO GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION 36141..36911 GB:FROM 36141 GB:TO 36911 GB:DIRECTION + GB:GENE recO GB:PRODUCT DNA repair protein RecO GB:NOTE identified by match to protein family HMM PF02565; match to protein family HMM TIGR00613 GB:PROTEIN_ID ACF55812.1 GB:DB_XREF GI:194357364 GB:GENE:GENE recO LENGTH 256 SQ:AASEQ MIQSITSQGLVLYNRNFREDDKLVKIFTEQVGKCMFFVKHAGQSKLAPVIQPLVLARFLLRINDDGLSYIEDYHEVMTFPKINSDLFVMAYATYVAALADASLQDNQQDAPLFAFLQKTLELMEAGLDYQVLTNIFEIQILTRFGISLNFNECVFCHRVGQAFDFSFKYGACLCPEHYHEDERRCHLNPNIPYLLNQFQAIDFETLETISLKPGIKQELRQFMDQLYEEYVGIHLKSKKFIDSLADWGQLLKEEKK GT:EXON 1|1-256:0| SW:ID RECO_STRP4 SW:DE RecName: Full=DNA repair protein recO;AltName: Full=Recombination protein O; SW:GN Name=recO; OrderedLocusNames=SPG_0042; SW:KW Complete proteome; DNA damage; DNA recombination; DNA repair. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->256|RECO_STRP4|e-142|100.0|256/256| GO:SWS:NREP 3 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| SEG 90->101|ayatyvaalada| HM:PFM:NREP 2 HM:PFM:REP 84->238|PF02565|1.4e-24|29.6|115/118|RecO_C| HM:PFM:REP 4->72|PF11967|9.3e-18|29.0|69/80|RecO_N| RP:SCP:NREP 2 RP:SCP:REP 3->70|1u5kA1|1e-16|16.4|67/78|b.40.4.13| RP:SCP:REP 102->244|1u5kA2|2e-17|12.7|134/157|g.45.1.2| HM:SCP:REP 1->79|1u5kA1|3.6e-15|32.1|78/0|b.40.4.13|1/1|Nucleic acid-binding proteins| HM:SCP:REP 81->234|1u5kA2|4.7e-42|33.3|153/0|g.45.1.2|1/1|ArfGap/RecO-like zinc finger| OP:NHOMO 143 OP:NHOMOORG 143 OP:PATTERN -------------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------11-----------------------------------------------------11111111111111111111111111111111111111111-1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--1-----------111----------------1-------1111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3,248-249,252-257| PSIPRED cccccEEEEEEEEEccccccccEEEEEcccccEEEEEEccccccccHHHcccccEEEEEEEEccccccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccccccccccccccccccEEEEEEcccEEcHHHcccccccccccHHHHHHHHHHHcccHHHHccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccc //