[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Streptococcus pneumoniae G54 (spne4)
Gene : recR
DDBJ      :recR         recombination protein RecR
Swiss-Prot:RECR_STRZT   RecName: Full=Recombination protein recR;

Homologs  Archaea  0/68 : Bacteria  873/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
e.49.1
:198 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   1->195 1vddA PDBj 2e-53 49.7 %
:RPS:PDB   68->198 1cy1A PDBj 6e-31 13.1 %
:RPS:SCOP  1->198 1vddA  e.49.1.1 * 6e-38 49.0 %
:HMM:SCOP  1->198 1vddA_ e.49.1.1 * 7.3e-75 49.5 %
:RPS:PFM   39->78 PF02132 * RecR 5e-11 55.0 %
:HMM:PFM   38->78 PF02132 * RecR 8.2e-18 46.3 41/41  
:HMM:PFM   81->170 PF01751 * Toprim 4.7e-12 23.3 90/96  
:BLT:SWISS 1->198 RECR_STRZT e-111 100.0 %
:PROS 57->78|PS01300|RECR

SeqInfo AminoSeq See neighboring genes
Links DAD Abbreviations Back to title page
GT:ID ACF56269.1 GT:GENE recR GT:PRODUCT recombination protein RecR GT:DATABASE GIB00761CH01 GT:ORG spne4 GB:ACCESSION GIB00761CH01 GB:LOCATION complement(1522595..1523191) GB:FROM 1522595 GB:TO 1523191 GB:DIRECTION - GB:GENE recR GB:PRODUCT recombination protein RecR GB:NOTE identified by match to protein family HMM PF01751; match to protein family HMM PF02132; match to protein family HMM TIGR00615 GB:PROTEIN_ID ACF56269.1 GB:DB_XREF GI:194357821 GB:GENE:GENE recR LENGTH 198 SQ:AASEQ MLYPTPIAKLIDSYSKLPGIGIKTATRLAFYTIGMSADDVNEFAKNLLSAKRELTYCSICGRLTDDDPCSICTDPTRDQTTILVLEDSRDVAAMENIQEYHGLYHVLHGLISPMNGISPDDINLKSLMTRLMDSEVSEVIVATNATADGEATSMYLSRLLKPAGIKVTRLARGLAVGADIEYADEVTLLRAIENRTEL GT:EXON 1|1-198:0| SW:ID RECR_STRZT SW:DE RecName: Full=Recombination protein recR; SW:GN Name=recR; OrderedLocusNames=SPT_1611; SW:KW Complete proteome; DNA damage; DNA recombination; DNA repair;Metal-binding; Zinc; Zinc-finger. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->198|RECR_STRZT|e-111|100.0|198/198| GO:SWS:NREP 4 GO:SWS GO:0006974|"GO:response to DNA damage stimulus"|DNA damage| GO:SWS GO:0006310|"GO:DNA recombination"|DNA recombination| GO:SWS GO:0006281|"GO:DNA repair"|DNA repair| GO:SWS GO:0046872|"GO:metal ion binding"|Metal-binding| PROS 57->78|PS01300|RECR|PDOC01004| BL:PDB:NREP 1 BL:PDB:REP 1->195|1vddA|2e-53|49.7|193/199| RP:PDB:NREP 1 RP:PDB:REP 68->198|1cy1A|6e-31|13.1|130/557| RP:PFM:NREP 1 RP:PFM:REP 39->78|PF02132|5e-11|55.0|40/41|RecR| HM:PFM:NREP 2 HM:PFM:REP 38->78|PF02132|8.2e-18|46.3|41/41|RecR| HM:PFM:REP 81->170|PF01751|4.7e-12|23.3|90/96|Toprim| GO:PFM:NREP 2 GO:PFM GO:0006281|"GO:DNA repair"|PF02132|IPR015967| GO:PFM GO:0006310|"GO:DNA recombination"|PF02132|IPR015967| RP:SCP:NREP 1 RP:SCP:REP 1->198|1vddA|6e-38|49.0|196/199|e.49.1.1| HM:SCP:REP 1->198|1vddA_|7.3e-75|49.5|196/199|e.49.1.1|1/1|Recombination protein RecR| OP:NHOMO 877 OP:NHOMOORG 875 OP:PATTERN -------------------------------------------------------------------- 1111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111--1111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111112111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111-111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111------11111111111111111-1111111111111-11111111111111111111111111111111111111-111111111111--11111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111--11111111---1-111111---11-111111-111111-11111----------111 -------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------1------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 198 STR:RPRED 100.0 SQ:SECSTR ccccHHHHHHHHHHTTcTTccHHHHHHHTTTTcccHHHHHHTGGGccHHHHHHHTTTEEEEEccHHHHHHHHHHHTcccTTEEEEEcccccEEcccHHHHHHHTEETTTTTEEccEEcTTHHHHHHHHHHHHHHTcccEEEcccccHHHHHHHHHHHHHHcccGGGEEEcccccccHHHHHHHccHHHHHHHHHHHHH DISOP:02AL 1-2,197-199| PSIPRED ccccHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccccccccccccHHccccccccEEEEEccHHHHHHHHHHcccccEEEEEccEEcccccccHHHccHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHHccccc //